BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120371.Seq (747 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 prot... 27 0.21 AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory recept... 23 2.0 AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory recept... 23 2.0 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 23 2.6 AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase ... 23 2.6 AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase ... 23 2.6 >EF125543-1|ABL73927.1| 475|Tribolium castaneum chitinase 4 protein. Length = 475 Score = 26.6 bits (56), Expect = 0.21 Identities = 13/33 (39%), Positives = 20/33 (60%) Frame = -2 Query: 374 GDTSNIVLLGPNLDLSLGNIL*HNLVEVSSCEL 276 GD S I L PNLD++ GN+ N +++ + L Sbjct: 60 GDDSRIKHLEPNLDVNQGNLKKFNALKLKNPNL 92 >AM292377-1|CAL23189.2| 358|Tribolium castaneum gustatory receptor candidate 56 protein. Length = 358 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 369 VTLPIFESYQDGSDTYEL 422 VT+ F SYQ G+ TY L Sbjct: 160 VTIIFFASYQYGTKTYSL 177 >AM292342-1|CAL23154.2| 386|Tribolium castaneum gustatory receptor candidate 21 protein. Length = 386 Score = 23.4 bits (48), Expect = 2.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = +3 Query: 369 VTLPIFESYQDGSDTYEL 422 VT+ F SYQ G+ TY L Sbjct: 160 VTIIFFASYQYGTKTYSL 177 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 23.0 bits (47), Expect = 2.6 Identities = 10/14 (71%), Positives = 10/14 (71%), Gaps = 1/14 (7%) Frame = -3 Query: 325 LVTF-CSTTWLKSP 287 LV F CST WLK P Sbjct: 306 LVNFDCSTMWLKDP 319 >AY295879-1|AAQ62692.1| 1464|Tribolium castaneum chitin synthase protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -3 Query: 607 CTFQPGN--DYVLNGVDTSIRDLNNLVES 527 CT++ N + L + S+RDLN +ES Sbjct: 1090 CTYKADNKENEQLRKIQESLRDLNRKIES 1118 >AY291477-1|AAQ55061.1| 1464|Tribolium castaneum chitin synthase CHS2 protein. Length = 1464 Score = 23.0 bits (47), Expect = 2.6 Identities = 11/29 (37%), Positives = 17/29 (58%), Gaps = 2/29 (6%) Frame = -3 Query: 607 CTFQPGN--DYVLNGVDTSIRDLNNLVES 527 CT++ N + L + S+RDLN +ES Sbjct: 1090 CTYKADNKENEQLRKIQESLRDLNRKIES 1118 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 159,700 Number of Sequences: 336 Number of extensions: 3434 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 19923648 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -