BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120369.Seq (821 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase ... 24 4.9 AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine... 24 6.5 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 8.6 >AF045250-1|AAC02700.1| 259|Anopheles gambiae serine proteinase protein. Length = 259 Score = 24.2 bits (50), Expect = 4.9 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -2 Query: 343 HSSYSLPLLTYDFGI*VLQH 284 H SY L + YD G+ L H Sbjct: 106 HESYDLSAIRYDIGVLQLSH 125 >AJ459779-1|CAD30839.1| 405|Anopheles gambiae clip-domain serine protease protein. Length = 405 Score = 23.8 bits (49), Expect = 6.5 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = -3 Query: 498 CIVCNNNRAELCYMIPSYCVLRKIVNNFTSISL*QKFS 385 C + N C M+P+ CV +N+ +S+S ++FS Sbjct: 41 CDIPNEPNPGQC-MLPAECVAYGKINDVSSLSSIERFS 77 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 8.6 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +1 Query: 316 LAEEVNKKNERISVLEREKSALIRELLLQRNRSK 417 L EE + R + +EREK +RE + R K Sbjct: 452 LREEERAREAREAAIEREKERELREQREREQREK 485 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 822,880 Number of Sequences: 2352 Number of extensions: 15465 Number of successful extensions: 26 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 26 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 26 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 87318630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -