BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120369.Seq (821 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly pro... 23 4.5 AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methylt... 22 6.0 >DQ000307-1|AAY21180.1| 423|Apis mellifera major royal jelly protein 9 protein. Length = 423 Score = 22.6 bits (46), Expect = 4.5 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -1 Query: 734 TFPLYCTIYYWLSICCYAMWHYSIA*FESS 645 +F ++ I Y+ SI C A HYS+ F+++ Sbjct: 2 SFNIWWLILYF-SIVCQAKAHYSLRDFKAN 30 >AM050259-1|CAJ18340.1| 683|Apis mellifera putative H3K9 methyltransferase protein. Length = 683 Score = 22.2 bits (45), Expect = 6.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +1 Query: 277 SNNAAVLRSQNRMLAEEVNKKN 342 S+N+ VL QN+ + +N+KN Sbjct: 152 SSNSDVLFKQNKEEEQTINRKN 173 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 222,270 Number of Sequences: 438 Number of extensions: 4822 Number of successful extensions: 11 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26217432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -