BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120366.Seq (845 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1142.04 |||Noc2p-Noc3p complex subunit Noc2 family |Schizosa... 27 4.4 SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyce... 27 4.4 >SPAC1142.04 |||Noc2p-Noc3p complex subunit Noc2 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 707 Score = 26.6 bits (56), Expect = 4.4 Identities = 10/17 (58%), Positives = 14/17 (82%) Frame = -3 Query: 258 RQKESSREGKEETSEKD 208 RQK S +EGK+ET ++D Sbjct: 33 RQKHSKKEGKDETLKRD 49 >SPAC20G8.06 |||CCR4-Not complex subunit Not1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 2100 Score = 26.6 bits (56), Expect = 4.4 Identities = 11/37 (29%), Positives = 21/37 (56%) Frame = -3 Query: 765 IRETCGTGNRRAVPNNKIVQSTSCFKLANSIEGESER 655 +R G N A+P N + TS ++++ S GE+++ Sbjct: 1518 LRTAVGGENPMALPGNFVNSITSLYEISESFSGETKQ 1554 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,724,350 Number of Sequences: 5004 Number of extensions: 46690 Number of successful extensions: 123 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 122 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 123 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 418457710 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -