BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120365.Seq (836 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprol... 26 1.2 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 25 3.8 AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding pr... 24 5.0 AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding pr... 24 5.0 AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcrip... 24 6.6 AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor O... 23 8.7 AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembran... 23 8.7 AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembran... 23 8.7 AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeo... 23 8.7 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 23 8.7 >AJ439398-7|CAD28130.1| 1344|Anopheles gambiae putative 5-oxoprolinase protein. Length = 1344 Score = 26.2 bits (55), Expect = 1.2 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = -2 Query: 679 LMQRSALKGRFIMRTLTKNTLKDSGAVVILTQLSVYSSTPYALVISI 539 + Q + L R ++RT+ + + +G+ V+ + + TP LV+ I Sbjct: 986 MQQNAELAVRDMLRTIAQEARERTGSAVLEAEQQMDDGTPIRLVVRI 1032 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 24.6 bits (51), Expect = 3.8 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = +3 Query: 510 EFDLVRFALQIDITSAYGVDEYTDNCVK 593 EF+ + LQ++ T+ G + TD CV+ Sbjct: 53 EFENAAYQLQVEATNTCGDETDTDFCVQ 80 >AY146731-1|AAO12091.1| 150|Anopheles gambiae odorant-binding protein AgamOBP4 protein. Length = 150 Score = 24.2 bits (50), Expect = 5.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 361 AELDVLTRQIYMSNPLVMLKCY 426 AEL L + I+ +NP LKCY Sbjct: 52 AELHGLRKSIFPANPDKELKCY 73 >AF437887-1|AAL84182.1| 150|Anopheles gambiae odorant binding protein protein. Length = 150 Score = 24.2 bits (50), Expect = 5.0 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +1 Query: 361 AELDVLTRQIYMSNPLVMLKCY 426 AEL L + I+ +NP LKCY Sbjct: 52 AELHGLRKSIFPANPDKELKCY 73 >AF230521-1|AAF36974.2| 185|Anopheles gambiae homeobox transcription factor protein. Length = 185 Score = 23.8 bits (49), Expect = 6.6 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -1 Query: 281 KSMHFNALLSRRRRYGMSQPRLQLT 207 K HFN L+RRRR ++ L+LT Sbjct: 23 KEFHFNRYLNRRRRIEIAS-MLKLT 46 >AY843205-1|AAX14774.1| 478|Anopheles gambiae odorant receptor Or83b protein. Length = 478 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = +3 Query: 90 ILRQRILKIACAIKLWLKQSWHLSKIVS 173 + R++ + + AIK W+++ H+ ++VS Sbjct: 318 LTRKQEMMVRSAIKYWVERHKHVVRLVS 345 >AY363726-1|AAR14939.1| 331|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 331 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = +3 Query: 90 ILRQRILKIACAIKLWLKQSWHLSKIVS 173 + R++ + + AIK W+++ H+ ++VS Sbjct: 171 LTRKQEMMVRSAIKYWVERHKHVVRLVS 198 >AY363725-1|AAR14938.1| 478|Anopheles gambiae seven transmembrane G protein-coupledreceptor protein. Length = 478 Score = 23.4 bits (48), Expect = 8.7 Identities = 8/28 (28%), Positives = 19/28 (67%) Frame = +3 Query: 90 ILRQRILKIACAIKLWLKQSWHLSKIVS 173 + R++ + + AIK W+++ H+ ++VS Sbjct: 318 LTRKQEMMVRSAIKYWVERHKHVVRLVS 345 >AF080565-1|AAC31945.1| 324|Anopheles gambiae Antennapedia homeotic protein protein. Length = 324 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 281 KSMHFNALLSRRRR 240 K HFN L+RRRR Sbjct: 261 KEFHFNRYLTRRRR 274 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 23.4 bits (48), Expect = 8.7 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 281 KSMHFNALLSRRRR 240 K HFN L+RRRR Sbjct: 297 KEFHFNRYLTRRRR 310 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 814,300 Number of Sequences: 2352 Number of extensions: 16344 Number of successful extensions: 73 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 73 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 88478514 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -