BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120365.Seq (836 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 24 2.0 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 2.0 M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-... 23 2.6 AF069739-1|AAC63272.2| 690|Apis mellifera translation initiatio... 23 4.6 M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-... 22 6.1 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 6.1 M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-... 22 8.1 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 22 8.1 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 8.1 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 8.1 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 8.1 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 725 VATRFERPVNVLAKDIFTNKFDYKIKRRL 811 + T+F ++LA+DI FD++ K L Sbjct: 375 INTKFYGMYDILARDILGYNFDFQNKNNL 403 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.8 bits (49), Expect = 2.0 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +2 Query: 725 VATRFERPVNVLAKDIFTNKFDYKIKRRL 811 + T+F ++LA+DI FD++ K L Sbjct: 375 INTKFYGMYDILARDILGYNFDFQNKNNL 403 >M29488-1|AAA27723.1| 86|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H55. ). Length = 86 Score = 23.4 bits (48), Expect = 2.6 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = -1 Query: 281 KSMHFNALLSRRRR 240 K HFN L+RRRR Sbjct: 25 KEFHFNRYLTRRRR 38 >AF069739-1|AAC63272.2| 690|Apis mellifera translation initiation factor 2 protein. Length = 690 Score = 22.6 bits (46), Expect = 4.6 Identities = 12/41 (29%), Positives = 20/41 (48%) Frame = +3 Query: 669 RCIKNFSLLGNEYHVLVSSLQRVLNDQLMCLRRTFSPTSLI 791 RC+K L YHVL + + + + +L+ +R S I Sbjct: 610 RCVKGILLKSGLYHVLRGN-ENIYSGKLISMRHLKEEVSSI 649 >M29493-1|AAA27728.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H90. ). Length = 74 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 281 KSMHFNALLSRRRR 240 K H+N L+RRRR Sbjct: 25 KEFHYNRYLTRRRR 38 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 22.2 bits (45), Expect = 6.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 281 KSMHFNALLSRRRR 240 K H+N L+RRRR Sbjct: 287 KEFHYNRYLTRRRR 300 >M29494-1|AAA27729.1| 74|Apis mellifera protein ( Bee homeobox-containing gene,partial cds, clone H15. ). Length = 74 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 281 KSMHFNALLSRRRR 240 K H+N L+RRRR Sbjct: 25 KEFHYNHYLTRRRR 38 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.8 bits (44), Expect = 8.1 Identities = 11/31 (35%), Positives = 16/31 (51%) Frame = +2 Query: 233 CHIDDDDSKAH*NA*ILIITAFAQKKCFATC 325 C I ++ NA +L ITAF ++ A C Sbjct: 127 CIIQSFAAETSANATVLTITAFTVERYIAIC 157 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 164 DCFEAVVCENGGLFVLTGGAAV 229 DC +A+ N L V++GG+ + Sbjct: 425 DCLKAIKENNADLTVVSGGSVL 446 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 164 DCFEAVVCENGGLFVLTGGAAV 229 DC +A+ N L V++GG+ + Sbjct: 425 DCLKAIKENNADLTVVSGGSVL 446 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 8.1 Identities = 8/22 (36%), Positives = 14/22 (63%) Frame = +2 Query: 164 DCFEAVVCENGGLFVLTGGAAV 229 DC +A+ N L V++GG+ + Sbjct: 425 DCLKAIKENNADLTVVSGGSVL 446 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 212,094 Number of Sequences: 438 Number of extensions: 3848 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26824317 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -