BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120364.Seq (804 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family pro... 106 2e-23 At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family pro... 105 3e-23 At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family pro... 104 6e-23 At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family pro... 101 6e-22 At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family pro... 100 1e-21 At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family pro... 100 1e-21 At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative ... 51 1e-06 At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative ... 49 3e-06 At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E... 48 1e-05 At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E... 48 1e-05 At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E... 48 1e-05 At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E... 48 1e-05 At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family pro... 46 4e-05 At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative ... 45 5e-05 At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13)... 43 2e-04 At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) id... 43 3e-04 At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11)... 42 4e-04 At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E... 42 5e-04 At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative ... 41 0.001 At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative ... 39 0.003 At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative ... 39 0.003 At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative ... 39 0.003 At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14)... 38 0.006 At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E... 38 0.008 At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E... 38 0.008 At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E... 38 0.008 At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E... 38 0.008 At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative ... 38 0.008 At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10)... 38 0.010 At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10)... 38 0.010 At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative ... 38 0.010 At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative ... 38 0.010 At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa ... 37 0.014 At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa ... 37 0.014 At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative ... 37 0.014 At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15)... 37 0.014 At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative ... 37 0.018 At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20)... 36 0.031 At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18)... 34 0.096 At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative ... 34 0.13 At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative ... 34 0.13 At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19)... 33 0.17 At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E... 33 0.17 At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16)... 33 0.17 At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E... 33 0.29 At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family pro... 32 0.51 At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17)... 31 0.68 At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E... 31 1.2 At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative ... 30 1.6 At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family pro... 30 2.1 At1g55915.1 68414.m06413 expressed protein similar to Hypothetic... 29 2.7 At2g47210.1 68415.m05896 myb family transcription factor contain... 29 3.6 At1g66700.3 68414.m07582 S-adenosyl-L-methionine:carboxyl methyl... 29 3.6 At3g18060.1 68416.m02297 transducin family protein / WD-40 repea... 29 4.8 At5g16590.1 68418.m01942 leucine-rich repeat transmembrane prote... 28 8.3 At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative ... 28 8.3 At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related si... 28 8.3 >At1g23260.1 68414.m02910 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 158 Score = 106 bits (254), Expect = 2e-23 Identities = 43/98 (43%), Positives = 64/98 (65%) Frame = +3 Query: 225 KGSGRWNHFLGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 404 KG G G++ DD+ + WTG I+GPP T YE +++ LK+ CG YP+ PPT RF Sbjct: 25 KGIGDGTVSYGMDDADDIYMQSWTGTILGPPNTAYEGKIFQLKLFCGKEYPESPPTVRFQ 84 Query: 405 SRIHMNCVNSQTGLVDNRQVPILARWQRDYTIKTVFKK 518 +RI+M CVN +TG+V+ P+L W+R+YT++ + K Sbjct: 85 TRINMACVNPETGVVEPSLFPMLTNWRREYTMEDILVK 122 Score = 55.6 bits (128), Expect = 4e-08 Identities = 23/34 (67%), Positives = 31/34 (91%) Frame = +1 Query: 154 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISW 255 M++ + VVVPRNFRLLEELE+G+KG+GDGT+S+ Sbjct: 1 MSSEEAKVVVPRNFRLLEELERGEKGIGDGTVSY 34 >At2g36060.1 68415.m04427 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 145 Score = 105 bits (253), Expect = 3e-23 Identities = 45/95 (47%), Positives = 63/95 (66%) Frame = +3 Query: 225 KGSGRWNHFLGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 404 KG G G++ DD+ + WTG IIGP T +E R+Y LK+ C YP++PPT RF Sbjct: 26 KGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFH 85 Query: 405 SRIHMNCVNSQTGLVDNRQVPILARWQRDYTIKTV 509 SRI+M CVN TG+VD+++ +LA WQR YT++ + Sbjct: 86 SRINMTCVNHDTGVVDSKKFGVLANWQRQYTMEDI 120 Score = 55.2 bits (127), Expect = 5e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 169 SGVVVPRNFRLLEELEQGQKGVGDGTISW 255 S VVVPRNFRLLEELE+G+KG+GDGT+S+ Sbjct: 7 SSVVVPRNFRLLEELERGEKGIGDGTVSY 35 >At3g52560.1 68416.m05784 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 104 bits (250), Expect = 6e-23 Identities = 44/95 (46%), Positives = 64/95 (67%) Frame = +3 Query: 225 KGSGRWNHFLGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 404 KG G G++ DD+ + WTG IIGP T +E R+Y LK+ C YP++PPT RF Sbjct: 27 KGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNTVHEGRIYQLKLFCDKDYPEKPPTVRFH 86 Query: 405 SRIHMNCVNSQTGLVDNRQVPILARWQRDYTIKTV 509 SR++M CVN +TG+VD ++ +LA WQR+YT++ + Sbjct: 87 SRVNMACVNHETGVVDPKKFGLLANWQREYTMEDI 121 Score = 55.6 bits (128), Expect = 4e-08 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +1 Query: 154 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISW 255 + + S VVVPRNFRLLEELE+G+KG+GDGT+S+ Sbjct: 3 LGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSY 36 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 500 QNSLQEVRRLMTLKDNMKLSQPPEGSTF 583 ++ L ++++ M+ N KL QPPEG+ F Sbjct: 119 EDILVQLKKEMSTSHNRKLVQPPEGTCF 146 >At2g36060.2 68415.m04428 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 146 Score = 101 bits (242), Expect = 6e-22 Identities = 45/96 (46%), Positives = 63/96 (65%), Gaps = 1/96 (1%) Frame = +3 Query: 225 KGSGRWNHFLGLESDDDMTLTHWTGMIIGPPR-TPYENRMYSLKIECGTRYPDEPPTARF 401 KG G G++ DD+ + WTG IIGP T +E R+Y LK+ C YP++PPT RF Sbjct: 26 KGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTVRF 85 Query: 402 ISRIHMNCVNSQTGLVDNRQVPILARWQRDYTIKTV 509 SRI+M CVN TG+VD+++ +LA WQR YT++ + Sbjct: 86 HSRINMTCVNHDTGVVDSKKFGVLANWQRQYTMEDI 121 Score = 55.2 bits (127), Expect = 5e-08 Identities = 23/29 (79%), Positives = 28/29 (96%) Frame = +1 Query: 169 SGVVVPRNFRLLEELEQGQKGVGDGTISW 255 S VVVPRNFRLLEELE+G+KG+GDGT+S+ Sbjct: 7 SSVVVPRNFRLLEELERGEKGIGDGTVSY 35 >At1g70660.1 68414.m08146 ubiquitin-conjugating enzyme family protein similar to TRAF6-regulated IKK activator 1 beta Uev1A [Homo sapiens] GI:10880969; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 159 Score = 100 bits (240), Expect = 1e-21 Identities = 41/93 (44%), Positives = 61/93 (65%) Frame = +3 Query: 225 KGSGRWNHFLGLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 404 KG G G++ DD+ + WTG I+GP T YE +++ LK+ CG YP+ PPT RF Sbjct: 25 KGIGDGTVSYGMDDADDILMQSWTGTILGPHNTAYEGKIFQLKLFCGKDYPESPPTVRFQ 84 Query: 405 SRIHMNCVNSQTGLVDNRQVPILARWQRDYTIK 503 SRI+M CVN + G+VD P+L+ W+R++T++ Sbjct: 85 SRINMACVNPENGVVDPSHFPMLSNWRREFTME 117 Score = 54.8 bits (126), Expect = 6e-08 Identities = 23/34 (67%), Positives = 29/34 (85%) Frame = +1 Query: 154 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISW 255 M + VVVPRNFRLLEELE+G+KG+GDGT+S+ Sbjct: 1 MGSEEEKVVVPRNFRLLEELERGEKGIGDGTVSY 34 >At3g52560.2 68416.m05785 ubiquitin-conjugating enzyme family protein similar to DNA-binding protein CROC-1B [Homo sapiens] GI:1066082; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 147 Score = 100 bits (239), Expect = 1e-21 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 1/96 (1%) Frame = +3 Query: 225 KGSGRWNHFLGLESDDDMTLTHWTGMIIGPPR-TPYENRMYSLKIECGTRYPDEPPTARF 401 KG G G++ DD+ + WTG IIGP T +E R+Y LK+ C YP++PPT RF Sbjct: 27 KGIGDGTVSYGMDDGDDIYMRSWTGTIIGPHNVTVHEGRIYQLKLFCDKDYPEKPPTVRF 86 Query: 402 ISRIHMNCVNSQTGLVDNRQVPILARWQRDYTIKTV 509 SR++M CVN +TG+VD ++ +LA WQR+YT++ + Sbjct: 87 HSRVNMACVNHETGVVDPKKFGLLANWQREYTMEDI 122 Score = 55.6 bits (128), Expect = 4e-08 Identities = 23/34 (67%), Positives = 30/34 (88%) Frame = +1 Query: 154 MANPSSGVVVPRNFRLLEELEQGQKGVGDGTISW 255 + + S VVVPRNFRLLEELE+G+KG+GDGT+S+ Sbjct: 3 LGSGGSSVVVPRNFRLLEELERGEKGIGDGTVSY 36 Score = 27.9 bits (59), Expect = 8.3 Identities = 11/28 (39%), Positives = 19/28 (67%) Frame = +2 Query: 500 QNSLQEVRRLMTLKDNMKLSQPPEGSTF 583 ++ L ++++ M+ N KL QPPEG+ F Sbjct: 120 EDILVQLKKEMSTSHNRKLVQPPEGTCF 147 >At5g25760.1 68418.m03057 ubiquitin-conjugating enzyme, putative similar to SP|O60015 Ubiquitin-conjugating enzyme E2-21 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) {Pichia angusta}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 157 Score = 50.8 bits (116), Expect = 1e-06 Identities = 22/58 (37%), Positives = 32/58 (55%) Frame = +3 Query: 270 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTG 443 DD + WT +I GP TPYE ++ L YP +PP RF+++I V+ +TG Sbjct: 30 DDTNIFKWTALIKGPSETPYEGGVFQLAFSVPEPYPLQPPQVRFLTKIFHPNVHFKTG 87 >At3g24515.1 68416.m03077 ubiquitin-conjugating enzyme, putative similar to Ubiquitin-conjugating enzyme E2 (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Xenopus laevis} SP|P51669, {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 409 Score = 49.2 bits (112), Expect = 3e-06 Identities = 30/83 (36%), Positives = 39/83 (46%), Gaps = 1/83 (1%) Frame = +3 Query: 264 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMNCVNSQT 440 S D T + I GP T Y N +++LKI+ RYP +PP F + I H N NS Sbjct: 38 SGDFSTFSTIDAQIEGPEDTVYANGIFNLKIQIPERYPFQPPIVSFATPIYHPNIDNSGR 97 Query: 441 GLVDNRQVPILARWQRDYTIKTV 509 +D +P WQ I TV Sbjct: 98 ICLDILNLPPKGAWQPSLNISTV 120 >At5g62540.1 68418.m07849 ubiquitin-conjugating enzyme 3 (UBC3) E2; identical to gi:431261, SP:P42746 Length = 150 Score = 47.6 bits (108), Expect = 1e-05 Identities = 19/51 (37%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Frame = +3 Query: 273 DMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 422 D + HW +I GP TP++ + L + YP++PP RF+SR+ H N Sbjct: 30 DNNIMHWNALIFGPEDTPWDGGTFKLTLHFTEDYPNKPPIVRFVSRMFHPN 80 >At2g02760.1 68415.m00219 ubiquitin-conjugating enzyme 2 (UBC2) E2; identical to gi:2689242, SP:P42745 Length = 152 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 255 GLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 422 G D+++ L W +I GP TP++ + L ++ YP++PPT RF+SR+ H N Sbjct: 26 GAPQDNNIML--WNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPN 80 >At1g14400.2 68414.m01708 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 255 GLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 422 G D+++ L W +I GP TP++ + L ++ YP++PPT RF+SR+ H N Sbjct: 26 GAPQDNNIML--WNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPN 80 >At1g14400.1 68414.m01707 ubiquitin-conjugating enzyme 1 (UBC1) E2; identical to gi:431259, SP:P25865 Length = 152 Score = 47.6 bits (108), Expect = 1e-05 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%) Frame = +3 Query: 255 GLESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 422 G D+++ L W +I GP TP++ + L ++ YP++PPT RF+SR+ H N Sbjct: 26 GAPQDNNIML--WNAVIFGPDDTPWDGGTFKLSLQFSEDYPNKPPTVRFVSRMFHPN 80 >At1g36340.1 68414.m04516 ubiquitin-conjugating enzyme family protein similar to Ubiquitin-conjugating enzyme E2-16 kDa (EC 6.3.2.19) (Ubiquitin-protein ligase) (Ubiquitin carrier protein) from {Schizosaccharomyces pombe} SP|P46595, {Caenorhabditis elegans} SP|P35129; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 154 Score = 45.6 bits (103), Expect = 4e-05 Identities = 21/55 (38%), Positives = 31/55 (56%) Frame = +3 Query: 291 WTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDN 455 WT +I GP TPYE M++L I+ T YP +PP F + I+ +N + + N Sbjct: 39 WTAVIRGPDGTPYEGGMFNLSIKFPTDYPFKPPKFTFKTPIYHPNINDEGSICMN 93 >At5g50870.1 68418.m06304 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin conjugating enzyme [Lycopersicon esculentum] GI:886679; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 192 Score = 45.2 bits (102), Expect = 5e-05 Identities = 27/76 (35%), Positives = 40/76 (52%), Gaps = 1/76 (1%) Frame = +3 Query: 282 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQ 461 LT TG I GP TPYE + + I YP EPP +F +++ ++SQ+G + Sbjct: 32 LTRLTGTIPGPIGTPYEGGTFQIDITMPDGYPFEPPKMQFSTKVWHPNISSQSGAI---C 88 Query: 462 VPILA-RWQRDYTIKT 506 + IL +W T+KT Sbjct: 89 LDILKDQWSPALTLKT 104 >At3g46460.1 68416.m05037 ubiquitin-conjugating enzyme 13 (UBC13) E2; identical to gi:992706 Length = 166 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/52 (40%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +3 Query: 270 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 422 D+ + W+ IIGPP T YE + + YP+ PPT RF S I H N Sbjct: 30 DEKNIFEWSVTIIGPPDTLYEGGFFYAIMSFPQNYPNSPPTVRFTSDIWHPN 81 >At3g13550.1 68416.m01703 ubiquitin-conjugating enzyme (COP10) identical to ubiquitin-conjugating enzyme COP10 [Arabidopsis thaliana] GI:20065779; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 182 Score = 42.7 bits (96), Expect = 3e-04 Identities = 20/45 (44%), Positives = 26/45 (57%) Frame = +3 Query: 282 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 416 L HW IIGP TPYE ++ L I + YP +PP F +RI+ Sbjct: 65 LYHWIATIIGPSGTPYEGGIFFLDIIFPSDYPFKPPKLVFKTRIY 109 >At3g08690.1 68416.m01010 ubiquitin-conjugating enzyme 11 (UBC11) E2; identical to gi:12643427, SP:P35134 Length = 148 Score = 42.3 bits (95), Expect = 4e-04 Identities = 16/49 (32%), Positives = 27/49 (55%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GPP +PY ++ + I YP +PP F ++++ +NS Sbjct: 32 HWQATIMGPPESPYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINS 80 >At5g59300.1 68418.m07430 ubiquitin-conjugating enzyme 7 (UBC7) E2; identical to gi:992703, SP:P42747 Length = 198 Score = 41.9 bits (94), Expect = 5e-04 Identities = 19/49 (38%), Positives = 26/49 (53%) Frame = +3 Query: 261 ESDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 407 +S D + W+ IIGPP T YE ++ + YP+ PPT RF S Sbjct: 59 QSCDCYNIFEWSVTIIGPPDTLYEGGFFNAIMTFPQNYPNSPPTVRFTS 107 >At3g08700.1 68416.m01011 ubiquitin-conjugating enzyme, putative strong similar to ubiquitin-conjugating enzymes E2-17 from [Arabidopsis thaliana] SP|P35134, SP|P35132, SP|P35133; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 149 Score = 40.7 bits (91), Expect = 0.001 Identities = 14/50 (28%), Positives = 30/50 (60%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQ 437 HW I+GP +PY ++++ I+ + YP +PP F ++++ ++S+ Sbjct: 33 HWQATIMGPHDSPYSGGVFTVSIDFSSDYPFKPPKVNFKTKVYHPNIDSK 82 >At1g78870.2 68414.m09194 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = +3 Query: 264 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 416 S+D+M ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 30 SEDNMR--YFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 >At1g78870.1 68414.m09193 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 112 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/51 (33%), Positives = 32/51 (62%) Frame = +3 Query: 264 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 416 S+D+M ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 30 SEDNMR--YFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 >At1g16890.2 68414.m02044 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 153 Score = 39.1 bits (87), Expect = 0.003 Identities = 15/51 (29%), Positives = 30/51 (58%) Frame = +3 Query: 264 SDDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 416 S + + ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 28 SPSEENMRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 78 >At3g55380.1 68416.m06151 ubiquitin-conjugating enzyme 14 (UBC14) E2; UbcAT3; identical to gi:2129757, S46656 Length = 167 Score = 38.3 bits (85), Expect = 0.006 Identities = 18/52 (34%), Positives = 26/52 (50%), Gaps = 1/52 (1%) Frame = +3 Query: 270 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMN 422 D+ + W+ I+GPP T YE ++ + YP PPT F S + H N Sbjct: 31 DEKNVFQWSVSIMGPPDTLYEGGFFNAIMSFPENYPVSPPTVTFTSEMWHPN 82 >At5g41700.4 68418.m05071 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 149 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 33 HWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 81 >At5g41700.3 68418.m05068 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 145 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 32 HWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 80 >At5g41700.2 68418.m05070 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 32 HWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 80 >At5g41700.1 68418.m05069 ubiquitin-conjugating enzyme 8 (UBC8) E2; identical to gi:297882, SP:P35131 Length = 148 Score = 37.9 bits (84), Expect = 0.008 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 32 HWQATIMGPAESPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 80 >At1g16890.1 68414.m02043 ubiquitin-conjugating enzyme, putative nearly identical to ubiquitin-conjugating enzyme E2 [Catharanthus roseus] GI:5381319; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 120 Score = 37.9 bits (84), Expect = 0.008 Identities = 14/45 (31%), Positives = 28/45 (62%) Frame = +3 Query: 282 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIH 416 + ++ MI+GP ++PYE ++ L++ YP P RF+++I+ Sbjct: 1 MRYFNVMILGPTQSPYEGGVFKLELFLPEEYPMAAPKVRFLTKIY 45 >At5g53300.2 68418.m06625 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 32 HWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 80 >At5g53300.1 68418.m06624 ubiquitin-conjugating enzyme 10 (UBC10) E2; identical to gi:297877, SP:P35133 Length = 148 Score = 37.5 bits (83), Expect = 0.010 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 32 HWQATIMGPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 80 >At2g32790.1 68415.m04014 ubiquitin-conjugating enzyme, putative similar to ubiquitin conjugating enzyme from [Oryza sativa] GI:1373001, {Arabidopsis thaliana} SP|P35134, SP|P35131; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 177 Score = 37.5 bits (83), Expect = 0.010 Identities = 25/75 (33%), Positives = 37/75 (49%), Gaps = 2/75 (2%) Frame = +3 Query: 291 WTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMNCVNSQTGLVDNRQVP 467 W + GP PYE ++++ + +YP EPP F ++I H N S+ G + V Sbjct: 62 WEATVNGPVGCPYEKGVFTVSVHIPPKYPYEPPKITFKTKIFHPNI--SEIGEI---FVD 116 Query: 468 IL-ARWQRDYTIKTV 509 IL +RW TI V Sbjct: 117 ILGSRWSSALTINLV 131 >At1g64230.1 68414.m07276 ubiquitin-conjugating enzyme, putative identical or nearly so to Ubiquitin-conjugating enzymes SP|P35132, SP|P35131, SP|P35133 from {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 37.5 bits (83), Expect = 0.010 Identities = 16/49 (32%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ VNS Sbjct: 32 HWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNS 80 >At4g27960.2 68417.m04012 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 178 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 62 HWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 110 >At4g27960.1 68417.m04011 ubiquitin-conjugating enzyme E2-17 kDa 9 (UBC9) E2; identical to gi:297883, SP:P35132; identical to cDNA UBC9 for ubiquitin conjugating enzyme homolog GI:297883 Length = 148 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 32 HWQATIMGPSDSPYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINS 80 >At2g16740.1 68415.m01920 ubiquitin-conjugating enzyme, putative strong similarity to SP|P35133 Ubiquitin-conjugating enzyme E2-17 kDa 10 (EC 6.3.2.19) (Ubiquitin- protein ligase 10) (Ubiquitin carrier protein 10) {Arabidopsis thaliana}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 37.1 bits (82), Expect = 0.014 Identities = 15/49 (30%), Positives = 25/49 (51%) Frame = +3 Query: 288 HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 HW I+GP +PY ++ + I YP +PP F +++ +NS Sbjct: 32 HWQATIMGPNESPYSGGVFLVNIHFPPDYPFKPPKVVFRTKVFHPNINS 80 >At1g45050.1 68414.m05165 ubiquitin-conjugating enzyme 15 (UBC15) E2; identical to ubiquitin-conjugating enzyme 15 GI:2801442 from [Arabidopsis thaliana] Length = 161 Score = 37.1 bits (82), Expect = 0.014 Identities = 17/42 (40%), Positives = 21/42 (50%) Frame = +3 Query: 282 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 407 L WT + G P T Y N Y L++E YP E P F+S Sbjct: 43 LQKWTIDVTGAPGTLYANETYQLQVEFPEHYPMEAPQVVFVS 84 >At5g05080.1 68418.m00539 ubiquitin-conjugating enzyme, putative similar to SP|Q16763 Ubiquitin-conjugating enzyme E2-24 kDa (EC 6.3.2.19) (Ubiquitin- protein ligase) (Ubiquitin carrier protein) {Homo sapiens}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 251 Score = 36.7 bits (81), Expect = 0.018 Identities = 16/45 (35%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = +3 Query: 303 IIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRI-HMNCVNS 434 I GP TPYEN ++ +K+ +P PP F+++I H N ++ Sbjct: 46 IEGPVGTPYENGLFRMKLALSHDFPHSPPKGYFMTKIFHPNVASN 90 >At1g50490.1 68414.m05662 ubiquitin-conjugating enzyme 20 (UBC20) nearly identical to ubiquitin-conjugating enzyme UBC20 [Arabidopsis thaliana] GI:22530867; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 180 Score = 35.9 bits (79), Expect = 0.031 Identities = 20/74 (27%), Positives = 31/74 (41%), Gaps = 1/74 (1%) Frame = +3 Query: 291 WTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQVPI 470 W G I G T +E Y L + YP +PP +F C + + N + I Sbjct: 67 WKGTITGSKDTVFEGTEYRLSLSFSNDYPFKPPKVKF----ETCCFHPNVDVYGNICLDI 122 Query: 471 LA-RWQRDYTIKTV 509 L +W Y ++T+ Sbjct: 123 LQDKWSSAYDVRTI 136 >At5g42990.1 68418.m05243 ubiquitin-conjugating enzyme 18 (UBC18) E2; identical to gi:2801448 Length = 161 Score = 34.3 bits (75), Expect = 0.096 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 282 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 404 L W + G P T Y N Y+L++E YP E P F+ Sbjct: 43 LQKWVIEVTGAPGTLYANETYNLQVEFPQHYPMEAPQVIFV 83 >At5g56150.2 68418.m07005 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +3 Query: 270 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 DDM W I+GP +P+ ++ + I YP +PP F ++++ +NS Sbjct: 28 DDMF--QWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINS 80 >At5g56150.1 68418.m07004 ubiquitin-conjugating enzyme, putative strong similarity to ubiquitin-conjugating enzyme UBC2 [Mesembryanthemum crystallinum] GI:5762457, UBC4 [Pisum sativum] GI:456568; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 148 Score = 33.9 bits (74), Expect = 0.13 Identities = 16/55 (29%), Positives = 28/55 (50%) Frame = +3 Query: 270 DDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNS 434 DDM W I+GP +P+ ++ + I YP +PP F ++++ +NS Sbjct: 28 DDMF--QWQATIMGPADSPFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINS 80 >At3g20060.1 68416.m02537 ubiquitin-conjugating enzyme 19 (UBC19) nearly identical to ubiquitin-conjugating enzyme UBC19 [Arabidopsis thaliana] GI:22530865; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 181 Score = 33.5 bits (73), Expect = 0.17 Identities = 20/74 (27%), Positives = 30/74 (40%), Gaps = 1/74 (1%) Frame = +3 Query: 291 WTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLVDNRQVPI 470 W G I G T +E Y L + YP + P +F C + L N + I Sbjct: 68 WKGTITGSKDTVFEGTEYRLSLTFSNDYPFKSPKVKF----ETCCFHPNVDLYGNICLDI 123 Query: 471 LA-RWQRDYTIKTV 509 L +W Y ++T+ Sbjct: 124 LQDKWSSAYDVRTI 137 >At2g46030.1 68415.m05726 ubiquitin-conjugating enzyme 6 (UBC6) E2; identical to gi|431267, SP:P42750, PIR:S52661; contains a ubiquitin-conjugating enzymes active site (PDOC00163) Length = 183 Score = 33.5 bits (73), Expect = 0.17 Identities = 16/61 (26%), Positives = 34/61 (55%) Frame = +3 Query: 267 DDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGL 446 +DD+ + + T GP + Y+ ++ +K+E YP + P+ F+++I+ V+ +G Sbjct: 26 NDDLQMFYVT--FHGPTDSLYQGGVWKIKVELPEAYPYKSPSVGFVNKIYHPNVDESSGA 83 Query: 447 V 449 V Sbjct: 84 V 84 >At1g75440.1 68414.m08763 ubiquitin-conjugating enzyme 16 (UBC16) E2; identical to gi:2801444, GB:AAC39325 from [Arabidopsis thaliana] (Plant Mol. Biol. 23 (2), 387-396 (1993)) Length = 161 Score = 33.5 bits (73), Expect = 0.17 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = +3 Query: 282 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFI 404 L W +IG P T Y N Y L+++ YP E P F+ Sbjct: 43 LQRWIIEVIGAPGTLYANDTYQLQVDFPEHYPMESPQVIFL 83 >At1g63800.1 68414.m07220 ubiquitin-conjugating enzyme 5 (UBC5) E2; identical to gi:431269, SP:P42749 Length = 185 Score = 32.7 bits (71), Expect = 0.29 Identities = 14/47 (29%), Positives = 27/47 (57%) Frame = +3 Query: 309 GPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLV 449 GP + YE ++ +++E YP + P+ FI++I+ V+ +G V Sbjct: 38 GPKDSIYEGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDEMSGSV 84 >At2g33770.1 68415.m04141 ubiquitin-conjugating enzyme family protein low similarity to ubiquitin-conjugating BIR-domain enzyme APOLLON [Homo sapiens] GI:8489831, ubiquitin-conjugating enzyme [Mus musculus] GI:3319990; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 907 Score = 31.9 bits (69), Expect = 0.51 Identities = 12/35 (34%), Positives = 19/35 (54%) Frame = +3 Query: 303 IIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 407 ++G P TPY + ++ I +YP EPP + S Sbjct: 698 LVGAPGTPYHDGLFFFDIMLPPQYPHEPPMVHYHS 732 >At4g36410.1 68417.m05173 ubiquitin-conjugating enzyme 17 (UBC17) E2; identical to gi:2801446 Length = 161 Score = 31.5 bits (68), Expect = 0.68 Identities = 15/40 (37%), Positives = 18/40 (45%) Frame = +3 Query: 282 LTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARF 401 L W + G P T Y N Y L++E YP E P F Sbjct: 43 LQRWIIEVHGVPGTLYANETYQLQVEFPEHYPMEAPQVIF 82 >At5g41340.1 68418.m05024 ubiquitin-conjugating enzyme 4 (UBC4) E2; identical to gi:431265, SP:P42748 Length = 187 Score = 30.7 bits (66), Expect = 1.2 Identities = 13/47 (27%), Positives = 27/47 (57%) Frame = +3 Query: 309 GPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNCVNSQTGLV 449 GP + Y+ ++ +++E YP + P+ FI++I+ V+ +G V Sbjct: 38 GPKDSLYQGGVWKIRVELPDAYPYKSPSVGFITKIYHPNVDELSGSV 84 >At3g17000.1 68416.m02171 ubiquitin-conjugating enzyme, putative similar to Non-Canonical UBiquitin Conjugating Enzyme 1 (NCUBE1) from [Gallus gallus] GI:7362937, [Mus musculus] GI:7363050, [Homo sapiens] GI:7362973; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 309 Score = 30.3 bits (65), Expect = 1.6 Identities = 23/87 (26%), Positives = 39/87 (44%), Gaps = 6/87 (6%) Frame = +3 Query: 264 SDDDMTLT------HWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFISRIHMNC 425 SDD M+L W I GP T +E +Y +I+ YP +PP+ ++ Sbjct: 28 SDDFMSLPLEENIFEWQFAIRGPGDTEFEGGIYHGRIQLPADYPFKPPSFMLLTPNGRFE 87 Query: 426 VNSQTGLVDNRQVPILARWQRDYTIKT 506 N++ L + P WQ ++++T Sbjct: 88 TNTKICLSISNYHP--EHWQPSWSVRT 112 >At1g53020.1 68414.m06002 ubiquitin-conjugating enzyme family protein similar to ubiquitin-conjugating enzyme GB:3319990 from [Mus musculus]; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 1163 Score = 29.9 bits (64), Expect = 2.1 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 3/47 (6%) Frame = +3 Query: 300 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS---RIHMNCVN 431 +IIG TPY + ++ I+ YP PP + S RI+ N N Sbjct: 306 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVHYHSGGLRINPNLYN 352 Score = 29.5 bits (63), Expect = 2.7 Identities = 18/53 (33%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = +3 Query: 300 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS---RIHMNCVNSQTGLV 449 +IIG TPY + ++ I+ YP PP + S RI+ N N LV Sbjct: 952 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPNVYYHSGGLRINPNLYNCGKVLV 1004 Score = 28.3 bits (60), Expect = 6.3 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = +3 Query: 300 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS 407 +IIG TPY + ++ I+ YP PP + S Sbjct: 640 VIIGAEGTPYHDGLFFFDIQFPDTYPSVPPKVHYHS 675 >At1g55915.1 68414.m06413 expressed protein similar to Hypothetical 30.6 kDa protein in ACT5-YCK1 intergenic region (Swiss-Prot:P38838) [Saccharomyces cerevisiae]; similar to Yhr134wp (GI:500671) [Saccharomyces cerevisiae] Length = 404 Score = 29.5 bits (63), Expect = 2.7 Identities = 15/35 (42%), Positives = 19/35 (54%) Frame = -2 Query: 380 IRVSCSTFNFKGVHSILVGCPWWANNHSSPMSKSH 276 IR +C++ N K V C W+N HS P S SH Sbjct: 236 IRETCTSVNGKSVKR----CNSWSNAHSCPPSSSH 266 >At2g47210.1 68415.m05896 myb family transcription factor contains Pfam profile: PF00249 myb DNA-binding domain Length = 441 Score = 29.1 bits (62), Expect = 3.6 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 1/61 (1%) Frame = +3 Query: 204 RRT*TRPKGSGRWNHFLGLESDDDMTLTHWTGMIIG-PPRTPYENRMYSLKIECGTRYPD 380 RR K + +W F DD+ L HW ++ PP Y Y+ ++ +Y D Sbjct: 60 RRPPADEKVAWKWLSFTNSARKDDLQLYHWVRVVNDVPPTGDYSFAKYNKSVDI-LKYTD 118 Query: 381 E 383 E Sbjct: 119 E 119 >At1g66700.3 68414.m07582 S-adenosyl-L-methionine:carboxyl methyltransferase family protein similar to defense-related protein cjs1 [Brassica carinata][GI:14009292][Mol Plant Pathol (2001) 2(3):159-169] Length = 259 Score = 29.1 bits (62), Expect = 3.6 Identities = 13/41 (31%), Positives = 23/41 (56%) Frame = +2 Query: 536 LKDNMKLSQPPEGSTF*FLQSSLNRPNLLSHKTIILK*INC 658 L+D +K+S+ P+G+ F+ SL+ H I++ NC Sbjct: 215 LRDGVKMSETPKGTVMDFIGESLSDLAKQVHNLIVIVLYNC 255 >At3g18060.1 68416.m02297 transducin family protein / WD-40 repeat family protein similar to 66 kDa stress protein (SP:P90587) [Physarum polycephalum (Slime mold)]; similar to WDR1 protein GB:AAD05042 [Gallus gallus] (Genomics 56 (1), 59-69 (1999)); contains 11 WD-40 repeats (PF00400) Length = 609 Score = 28.7 bits (61), Expect = 4.8 Identities = 15/41 (36%), Positives = 20/41 (48%) Frame = -2 Query: 347 GVHSILVGCPWWANNHSSPMSKSHIIIAFKTQEMVPSPTPF 225 GV +LVGC W N+H +S I F ++ SP F Sbjct: 281 GVDDMLVGC-LWQNDHIVTVSLGGTISIFSASDLDKSPFQF 320 >At5g16590.1 68418.m01942 leucine-rich repeat transmembrane protein kinase, putative Length = 625 Score = 27.9 bits (59), Expect = 8.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +3 Query: 336 RMYSLKIECGTRYPDEPPTARFISRI 413 R+ ++ I C T+YPD PT ++R+ Sbjct: 584 RLLNIGISCTTQYPDSRPTMPEVTRL 609 >At3g57870.1 68416.m06451 ubiquitin-conjugating enzyme, putative strong similarity to SP|P50550 Ubiquitin-like protein SUMO-1 conjugating enzyme (EC 6.3.2.19) (SUMO- 1-protein ligase) (Ubiquitin carrier protein) (Ubiquitin-conjugating enzyme UbcE2A) {Xenopus laevis}; contains Pfam profile PF00179: Ubiquitin-conjugating enzyme Length = 160 Score = 27.9 bits (59), Expect = 8.3 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = +3 Query: 267 DDDMTLTHWTGMIIGPPRTPYENRMYSLKIECGTRYPDEPPTARF 401 D + L W I G T +E + L + YP +PP +F Sbjct: 34 DGTVNLMVWHCTIPGKAGTDWEGGFFPLTMHFSEDYPSKPPKCKF 78 >At3g15355.1 68416.m01945 ubiquitin-conjugating enzyme-related similar to ubiquitin-conjugating enzyme (GI:3319990) [Mus musculus]; similar to Baculoviral IAP repeat-containing protein 6 (Ubiquitin-conjugating BIR-domain enzyme apollon) (Swiss-Prot:Q9NR09) [Homo sapiens]; Length = 609 Score = 27.9 bits (59), Expect = 8.3 Identities = 16/47 (34%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 300 MIIGPPRTPYENRMYSLKIECGTRYPDEPPTARFIS---RIHMNCVN 431 +IIG TPY + ++ I YP PP + S RI+ N N Sbjct: 367 VIIGAQGTPYHDGLFFFDIFFPDTYPSTPPIVHYHSGGLRINPNLYN 413 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,186,769 Number of Sequences: 28952 Number of extensions: 364121 Number of successful extensions: 890 Number of sequences better than 10.0: 57 Number of HSP's better than 10.0 without gapping: 858 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 887 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1824072800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -