BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120360.Seq (685 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50345| Best HMM Match : Cadherin (HMM E-Value=0) 32 0.50 SB_38709| Best HMM Match : Ank (HMM E-Value=3.6e-10) 30 2.0 SB_49053| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=8) 29 3.5 SB_26161| Best HMM Match : Herpes_LP (HMM E-Value=1.7) 29 3.5 SB_3748| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.6 SB_57805| Best HMM Match : Myotub-related (HMM E-Value=4.2) 28 6.1 SB_47324| Best HMM Match : Lipase_GDSL (HMM E-Value=0.019) 28 6.1 SB_23525| Best HMM Match : Lipase_GDSL (HMM E-Value=0.4) 28 6.1 >SB_50345| Best HMM Match : Cadherin (HMM E-Value=0) Length = 1021 Score = 31.9 bits (69), Expect = 0.50 Identities = 14/35 (40%), Positives = 22/35 (62%) Frame = +1 Query: 415 LKCYQNGAYRLNGQIDLHLNRHIKCIKTQYNVSLI 519 L+ NG R +G++ LH+ +KC K QYN S++ Sbjct: 545 LQAKDNGRERKHGEMTLHVT--VKCAKYQYNFSIV 577 >SB_38709| Best HMM Match : Ank (HMM E-Value=3.6e-10) Length = 218 Score = 29.9 bits (64), Expect = 2.0 Identities = 24/84 (28%), Positives = 35/84 (41%), Gaps = 3/84 (3%) Frame = -2 Query: 297 KAVIIKIYAF*CAFESSSSIW---HVTAAPPVNTNKPPFSQTTASKQSLINANFALATIL 127 K V YA A S +S+ H+ A P NKP S T ++ N +L Sbjct: 118 KRVTFSKYALLLAAASENSLQELEHLLDADPRYVNKPSSSGQTPLHKAAGKGNIESVRLL 177 Query: 126 SRKRSSISFVVI*GRTPRFS*FNK 55 + + ++F GRTP +NK Sbjct: 178 LTRGADVNFADKQGRTPMLLAWNK 201 >SB_49053| Best HMM Match : Adeno_E3_CR2 (HMM E-Value=8) Length = 182 Score = 29.1 bits (62), Expect = 3.5 Identities = 16/44 (36%), Positives = 24/44 (54%) Frame = +1 Query: 406 LVMLKCYQNGAYRLNGQIDLHLNRHIKCIKTQYNVSLIWLDLHY 537 LVM QN + ++ H N+H CIK Q ++L W DL++ Sbjct: 115 LVMFNTRQNSS--CPPLVNRHYNQHEFCIKIQVRITLYW-DLNF 155 >SB_26161| Best HMM Match : Herpes_LP (HMM E-Value=1.7) Length = 412 Score = 29.1 bits (62), Expect = 3.5 Identities = 17/53 (32%), Positives = 25/53 (47%) Frame = +2 Query: 239 IDDDDSKAH*NA*ILIITAFAQKKCFATCKLIYKNASTNITLNWTC*RVKFTC 397 + D++ + +A L + AFA KKC T + KNA + W C R C Sbjct: 350 VGDEELEDFDDAARLSLPAFA-KKCMDTAAVCRKNAGKDWNKRWACRRAFVKC 401 >SB_3748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 761 Score = 28.7 bits (61), Expect = 4.6 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 241 RRRRLKSALKCIDFDYYGLCSKKM 312 R R +K K I D YG+C+KKM Sbjct: 244 RERFIKQLSKYIPVDVYGICAKKM 267 >SB_57805| Best HMM Match : Myotub-related (HMM E-Value=4.2) Length = 167 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/29 (41%), Positives = 18/29 (62%) Frame = -1 Query: 574 YSSTPYALVISICSANLTKSNSRCTVFLC 488 + +T + L IS CS + T SRC ++LC Sbjct: 83 HCATYHTLPISHCSTSYTLPISRCALYLC 111 >SB_47324| Best HMM Match : Lipase_GDSL (HMM E-Value=0.019) Length = 233 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 444 TKRSNRFALKPPYKMHKNTVQREFD 518 T+RS R A PPYK K T+ +D Sbjct: 187 TERSERRARAPPYKQQKRTMWGSYD 211 >SB_23525| Best HMM Match : Lipase_GDSL (HMM E-Value=0.4) Length = 187 Score = 28.3 bits (60), Expect = 6.1 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = +3 Query: 444 TKRSNRFALKPPYKMHKNTVQREFD 518 T+RS R A PPYK K T+ +D Sbjct: 141 TERSERRARPPPYKQQKRTMWGSYD 165 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,674,507 Number of Sequences: 59808 Number of extensions: 381353 Number of successful extensions: 1017 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1017 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1769412099 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -