BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120358.Seq (791 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory recept... 23 2.1 U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. 21 8.5 >AM292355-1|CAL23167.1| 324|Tribolium castaneum gustatory receptor candidate 34 protein. Length = 324 Score = 23.4 bits (48), Expect = 2.1 Identities = 8/30 (26%), Positives = 18/30 (60%) Frame = +1 Query: 304 LDRYFFLKYEVTQVRAYLIQHVCMGLFIFI 393 +D FF ++E ++ +LI ++ + IF+ Sbjct: 219 IDDLFFFRFEKSKFEPFLISNISLVSLIFL 248 >U09586-3|AAC47272.1| 470|Tribolium castaneum integrase protein. Length = 470 Score = 21.4 bits (43), Expect = 8.5 Identities = 9/25 (36%), Positives = 18/25 (72%), Gaps = 1/25 (4%) Frame = -1 Query: 179 YQIAEPHILELCGIFSII-LRMWYR 108 YQIA+P E+ G++++ L+ ++R Sbjct: 443 YQIADPVTNEIKGVYNMTNLKFYHR 467 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 173,429 Number of Sequences: 336 Number of extensions: 3733 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -