BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120358.Seq (791 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces... 26 5.4 SPAC3G9.14 |sak1||transcriptional repressor Sak1|Schizosaccharom... 26 7.1 >SPAC6F12.02 |rst2||transcription factor Rst2|Schizosaccharomyces pombe|chr 1|||Manual Length = 567 Score = 26.2 bits (55), Expect = 5.4 Identities = 22/62 (35%), Positives = 29/62 (46%), Gaps = 6/62 (9%) Frame = -3 Query: 177 SDSGTTHTRIMWNILDNSKDVVSSINALQRWHAVSQ------*SELLEAKQRTDHLKRSG 16 SDSGT++ ++ NSK V SS A + +A Q A R +HLKR Sbjct: 30 SDSGTSNANTPSSVTSNSKPVASSTAAKKDPNAPPQKVKQYVCETCTRAFARLEHLKRHI 89 Query: 15 RS 10 RS Sbjct: 90 RS 91 >SPAC3G9.14 |sak1||transcriptional repressor Sak1|Schizosaccharomyces pombe|chr 1|||Manual Length = 766 Score = 25.8 bits (54), Expect = 7.1 Identities = 12/17 (70%), Positives = 14/17 (82%) Frame = -3 Query: 543 SEMSLKPNSLSPSILTL 493 SE+S PNSLSPS+L L Sbjct: 418 SEISNFPNSLSPSLLAL 434 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,021,858 Number of Sequences: 5004 Number of extensions: 59325 Number of successful extensions: 145 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 141 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 385381248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -