BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120358.Seq (791 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_05_0228 + 23454434-23455456,23456151-23456555,23456657-23457004 31 1.4 12_01_0610 + 5030130-5030247,5030957-5033193 28 9.8 >05_05_0228 + 23454434-23455456,23456151-23456555,23456657-23457004 Length = 591 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/69 (23%), Positives = 28/69 (40%) Frame = -3 Query: 279 VTPVRVTPLSPNTRMNIKGSSSI*KPQDVQRHLLSDSGTTHTRIMWNILDNSKDVVSSIN 100 V P + P++ + G P+D+ L D+ R W L ++ S ++ Sbjct: 117 VIPDEILGADPSSTLQAPGPGGGAIPEDLLAALHLDASNPVVRAAWGALSRLDELTSGLS 176 Query: 99 ALQRWHAVS 73 QRW A + Sbjct: 177 GPQRWAAAA 185 >12_01_0610 + 5030130-5030247,5030957-5033193 Length = 784 Score = 27.9 bits (59), Expect = 9.8 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -2 Query: 379 DPYIHAVLNTLLPVLPHTLEKNIDPNSS 296 D ++ + NT LP LPH L + PN S Sbjct: 380 DSFLLSQANTRLPSLPHLLSSLLKPNPS 407 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,494,256 Number of Sequences: 37544 Number of extensions: 309828 Number of successful extensions: 520 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 520 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -