Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120358.Seq
         (791 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At4g20980.1 68417.m03037 eukaryotic translation initiation facto...    28   6.2  

>At4g20980.1 68417.m03037 eukaryotic translation initiation factor 3
           subunit 7, putative / eIF-3 zeta, putative / eIF3d,
           putative similar to initiation factor 3d [Arabidopsis
           thaliana] GI:12407755, SP|O15371 Eukaryotic translation
           initiation factor 3 subunit 7 (eIF-3 zeta) (eIF3 p66)
           (eIF3d) {Homo sapiens}; contains Pfam profile PF05091:
           Eukaryotic translation initiation factor 3 subunit 7
           (eIF-3)
          Length = 591

 Score = 28.3 bits (60), Expect = 6.2
 Identities = 14/49 (28%), Positives = 24/49 (48%)
 Frame = -1

Query: 197 TYNAIYYQIAEPHILELCGIFSIILRMWYRL*TRCRGGTQSVSNRNYSK 51
           T++ + Y + EP  L LCG      R++ R+  +     +   NRN+ K
Sbjct: 201 TFSKLSYTVQEPEDLLLCGGLEYYNRLFDRITPKNERRLERFKNRNFFK 249


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 14,945,638
Number of Sequences: 28952
Number of extensions: 280225
Number of successful extensions: 522
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 518
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 522
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1785055200
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)