BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120356.Seq (770 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. 25 2.6 AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase... 24 6.0 >DQ342048-1|ABC69940.1| 847|Anopheles gambiae STIP protein. Length = 847 Score = 25.0 bits (52), Expect = 2.6 Identities = 12/31 (38%), Positives = 16/31 (51%), Gaps = 4/31 (12%) Frame = +1 Query: 106 LDLCASVKLTP----FKPMRPPKPMQCWIHP 186 L+ VKLT + P+ P+ CWIHP Sbjct: 542 LEQIVLVKLTAAVIEWDPLTDTVPIHCWIHP 572 >AY280613-1|AAQ21366.1| 257|Anopheles gambiae carbonic anhydrase alternate isoform protein. Length = 257 Score = 23.8 bits (49), Expect = 6.0 Identities = 9/29 (31%), Positives = 16/29 (55%) Frame = -2 Query: 523 YQNVLSSASLPMYLMTVSMMIFKTPMLCS 437 Y S + P Y +V+ +++KTP+ S Sbjct: 178 YYTYKGSLTTPPYFESVTWLVYKTPIYVS 206 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 747,255 Number of Sequences: 2352 Number of extensions: 15419 Number of successful extensions: 19 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 19 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -