BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120356.Seq (770 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 23 2.4 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 23 3.1 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 23 4.2 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 23 4.2 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 23 4.2 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 23 4.2 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 23 4.2 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 23 4.2 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 23 4.2 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 23 4.2 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.5 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 7.3 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.6 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 23.4 bits (48), Expect = 2.4 Identities = 8/17 (47%), Positives = 15/17 (88%) Frame = +3 Query: 447 MGVLKIIIDTVIKYIGK 497 MG++++I+ TV KY+G+ Sbjct: 146 MGIVELIMFTVNKYVGE 162 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 23.0 bits (47), Expect = 3.1 Identities = 8/33 (24%), Positives = 20/33 (60%) Frame = +2 Query: 152 GRPSRCNAGYILDERIAK*RVHVTIIQIPITKT 250 G+PS+ N G + + + + V+++ +P+ +T Sbjct: 538 GQPSKRNGGETNKQELKRLKSTVSLLPLPLART 570 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.6 bits (46), Expect = 4.2 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +2 Query: 419 KRRRGWRTQHGRFKDHHR 472 +RRR W Q R ++H R Sbjct: 37 RRRREWMIQQEREREHER 54 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 5.5 Identities = 11/31 (35%), Positives = 15/31 (48%), Gaps = 4/31 (12%) Frame = +1 Query: 106 LDLCASVKLT----PFKPMRPPKPMQCWIHP 186 LD+ KLT + P+ P+ WIHP Sbjct: 515 LDMLVLPKLTLEVEEWNPLTDTVPIHTWIHP 545 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 7.3 Identities = 11/40 (27%), Positives = 17/40 (42%) Frame = +2 Query: 629 SGQSVDVCNELKYPWNLITANSFIVSTDESRQSQYIYRTF 748 SG +CN +KY N S I + ++ YR + Sbjct: 147 SGMFEALCNHIKYSTNKGNIRSAITIFPQRTDGKHDYRVW 186 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.4 bits (43), Expect = 9.6 Identities = 16/62 (25%), Positives = 28/62 (45%), Gaps = 2/62 (3%) Frame = +2 Query: 464 HHRYGHQVHWQTGRREYILIAD--RMYVDLIYSEFRAIILPQSAYIIKGDYAESDSESGQ 637 +H G HW +GRR+ + RM V ++ + F P A + YA++ + + Sbjct: 261 NHLSGGTNHWDSGRRKSAAQRNVIRMLVAVVVA-FFICWAPFHAQRLLAVYAQNSKDKPE 319 Query: 638 SV 643 V Sbjct: 320 DV 321 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 393 KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKY 488 +PI + +RSVDE L ++ + KY Sbjct: 1152 EPILADMWRSVDEMEVRKTSALTTVLTGLRKY 1183 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = +3 Query: 393 KPIRTEHFRSVDEAGEHNMGVLKIIIDTVIKY 488 +PI + +RSVDE L ++ + KY Sbjct: 1148 EPILADMWRSVDEMEVRKTSALTTVLTGLRKY 1179 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,342 Number of Sequences: 438 Number of extensions: 4267 Number of successful extensions: 21 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 21 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -