BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120355.Seq (813 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC21C3.18 |spo4||serine/threonine protein kinase Spo4|Schizosa... 27 2.4 SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Sch... 25 9.7 >SPBC21C3.18 |spo4||serine/threonine protein kinase Spo4|Schizosaccharomyces pombe|chr 2|||Manual Length = 429 Score = 27.5 bits (58), Expect = 2.4 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 243 KINVQNVPSYIYII*KNLMHVNDKEIINNTDKSNNFLYKTY 365 K ++ + +Y+ + K L H++ K II+ K NF + Y Sbjct: 153 KYSLPEIGAYLRDLLKGLAHIDAKGIIHRDIKPGNFAWNPY 193 >SPBC6B1.06c |ubp14|ucp2|ubiquitin C-terminal hydrolase Ubp14|Schizosaccharomyces pombe|chr 2|||Manual Length = 775 Score = 25.4 bits (53), Expect = 9.7 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +1 Query: 10 LYRKQPTSCIKNHTEESNIDMC 75 +YR++ C + EE ID+C Sbjct: 20 IYREECVRCFNSQDEEGGIDLC 41 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,952,769 Number of Sequences: 5004 Number of extensions: 57283 Number of successful extensions: 98 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 95 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 98 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 396433620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -