BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120354.Seq (636 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. 25 1.5 AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. 25 1.5 AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. 25 1.5 AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. 25 1.5 DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domai... 25 2.7 AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precu... 24 3.5 CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase ... 23 6.1 AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR prot... 23 6.1 DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. 23 8.1 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 23 8.1 >U51225-1|AAA96405.1| 692|Anopheles gambiae hexamerin protein. Length = 692 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 404 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 493 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020872-1|AAC31875.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 404 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 493 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020871-1|AAC31874.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 404 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 493 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >AF020870-1|AAC31873.1| 692|Anopheles gambiae hexamerin A protein. Length = 692 Score = 25.4 bits (53), Expect = 1.5 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +2 Query: 404 AVLCTGKYAPAVKMDTNYGVIEELNKKLAF 493 AVL +G Y P+ K + Y E L K+ F Sbjct: 13 AVLASGSYVPSTKFEAKYADKEFLFKQKFF 42 >DQ370037-1|ABD18598.1| 121|Anopheles gambiae putative TIL domain polypeptide protein. Length = 121 Score = 24.6 bits (51), Expect = 2.7 Identities = 15/67 (22%), Positives = 26/67 (38%) Frame = +1 Query: 184 VIVNVDKKYKTTYSESGSIPYTPAQTTWSSKVTHCTCSRTQCSSPRRVLSN*L*RASSLT 363 V++ +K ++P TP +T + + +C+ PR V + T Sbjct: 17 VVIASAEKTDQEAEHGETVPATPEPSTTEATEEESPPPKIECTDPREVYNECGSSCDDRT 76 Query: 364 LWNCRRG 384 N RRG Sbjct: 77 CENIRRG 83 >AY994089-1|AAX86002.1| 267|Anopheles gambiae hyp37.7-like precursor protein. Length = 267 Score = 24.2 bits (50), Expect = 3.5 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = -1 Query: 570 QSGVGGHQRIGKMYNFFVGLG 508 Q+ +G Q + ++YN+F G+G Sbjct: 124 QNYIGHTQDVPRIYNYFAGVG 144 >CR954257-9|CAJ14160.1| 573|Anopheles gambiae putative esterase protein. Length = 573 Score = 23.4 bits (48), Expect = 6.1 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = -2 Query: 236 DPDSLYVVLYFLSTLTIT 183 +P +L +VL FLS LT+T Sbjct: 6 EPRALGIVLAFLSVLTLT 23 >AY391745-1|AAR28995.1| 460|Anopheles gambiae putative GPCR protein. Length = 460 Score = 23.4 bits (48), Expect = 6.1 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = -1 Query: 249 GIWYRPRLAVRRFVFFVNINYHSLFTI 169 GI R ++++ FF+NI +LFT+ Sbjct: 270 GILRRSSMSMKDRNFFINITLFALFTL 296 >DQ974161-1|ABJ52801.1| 409|Anopheles gambiae serpin 2 protein. Length = 409 Score = 23.0 bits (47), Expect = 8.1 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 225 RVGVYTIYPGPDNVVKQ 275 ++ +Y I P PDN V Q Sbjct: 255 KLAMYFILPNPDNTVNQ 271 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 23.0 bits (47), Expect = 8.1 Identities = 11/45 (24%), Positives = 24/45 (53%) Frame = +3 Query: 321 EGVIQLIMKSKLPYAVELQAWLLEEVIPQCCARASTRRPSRWTQI 455 EGV ++ + P E+++ LL+ V+P+ + P+ W+ + Sbjct: 964 EGVEHVMFEC--PRFAEVRSELLDGVLPETLEAHMLQSPTNWSNV 1006 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 674,382 Number of Sequences: 2352 Number of extensions: 13496 Number of successful extensions: 31 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 31 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 31 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 62305095 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -