BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120349.Seq (772 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggeri... 24 1.5 DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory pro... 23 2.7 >EF222294-1|ABN79654.1| 451|Tribolium castaneum ecdysis triggering hormone receptorisoform B protein. Length = 451 Score = 23.8 bits (49), Expect = 1.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -1 Query: 751 FRSLTYWQAYEPISESLRIILHIYITCSWFDR 656 FR+LT+W P + I Y +F R Sbjct: 308 FRALTFWIIVAPAGSNFEIGFENYYNILYFSR 339 >DQ855503-1|ABH88190.1| 124|Tribolium castaneum chemosensory protein 17 protein. Length = 124 Score = 23.0 bits (47), Expect = 2.7 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +3 Query: 192 YNPSCLFRSRSNHA*RFEGLN 254 Y+P ++SR NH EGLN Sbjct: 104 YDPKGEYKSRYNHFLEEEGLN 124 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 181,718 Number of Sequences: 336 Number of extensions: 4208 Number of successful extensions: 8 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20753800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -