BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120349.Seq (772 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0118 + 25735966-25737601,25737698-25738488 31 1.3 03_05_0257 + 22439915-22440275,22440280-22440627,22440962-224410... 29 4.1 >05_06_0118 + 25735966-25737601,25737698-25738488 Length = 808 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = -1 Query: 727 AYEPISESLRIILHIYITCSWFDRNSCDAMLS 632 AY+P+S +L I+ I +TCS + D S Sbjct: 381 AYDPVSRTLETIVSIMVTCSAYQNEKSDIRFS 412 >03_05_0257 + 22439915-22440275,22440280-22440627,22440962-22441015, 22441390-22441763 Length = 378 Score = 29.1 bits (62), Expect = 4.1 Identities = 10/32 (31%), Positives = 19/32 (59%) Frame = -1 Query: 331 LKWSRKIILLVVGRKKNLETRVPSLRLSPSNR 236 + W K+++ V R++ +ETR LR+ + R Sbjct: 258 ISWKPKLVIAAVARRRQVETREGGLRVGTAGR 289 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,542,560 Number of Sequences: 37544 Number of extensions: 370239 Number of successful extensions: 638 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 614 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 638 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2075009728 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -