BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120349.Seq (772 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_58313| Best HMM Match : UPF0180 (HMM E-Value=3.4) 30 1.8 SB_11120| Best HMM Match : DUF1080 (HMM E-Value=0.082) 29 4.2 SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) 29 5.5 >SB_58313| Best HMM Match : UPF0180 (HMM E-Value=3.4) Length = 478 Score = 30.3 bits (65), Expect = 1.8 Identities = 14/40 (35%), Positives = 24/40 (60%) Frame = -1 Query: 760 ICGFRSLTYWQAYEPISESLRIILHIYITCSWFDRNSCDA 641 +C L +W Y+ + ++ RII H ITC+ F ++CD+ Sbjct: 80 LCAKEDLRWW--YDNVMDAHRIIRHPAITCT-FQTDACDS 116 >SB_11120| Best HMM Match : DUF1080 (HMM E-Value=0.082) Length = 748 Score = 29.1 bits (62), Expect = 4.2 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +1 Query: 16 GLKRDLLTCQQFILANNNFRNFEIH 90 G K D+L+C F LANN + + H Sbjct: 21 GAKYDVLSCHSFNLANNQYEQYADH 45 >SB_53466| Best HMM Match : SCP (HMM E-Value=2.4e-27) Length = 5087 Score = 28.7 bits (61), Expect = 5.5 Identities = 15/44 (34%), Positives = 23/44 (52%) Frame = -1 Query: 367 DALRSNRQQGVKLKWSRKIILLVVGRKKNLETRVPSLRLSPSNR 236 D R+ +K +R+II + +K L+T PS+ SPS R Sbjct: 2445 DGFRTTTITTTTVKTTRRIISTTMDKKGPLDTDEPSVESSPSQR 2488 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,801,523 Number of Sequences: 59808 Number of extensions: 478622 Number of successful extensions: 776 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 709 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 775 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -