BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120349.Seq (772 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AC024817-2|AAU87810.1| 520|Caenorhabditis elegans Hypothetical ... 31 0.91 Z99102-2|CAB11775.1| 499|Caenorhabditis elegans Hypothetical pr... 29 3.7 >AC024817-2|AAU87810.1| 520|Caenorhabditis elegans Hypothetical protein Y54G2A.38 protein. Length = 520 Score = 31.1 bits (67), Expect = 0.91 Identities = 22/61 (36%), Positives = 33/61 (54%), Gaps = 1/61 (1%) Frame = -1 Query: 712 SESLRIILHIYITCSWFDRNSCDAMLSFLFAIRGSDSKYQQTSSCLVICISIHV-NKHYQ 536 S++L L+ IT + D +LS LFA G D++Y TSS L C +H N ++Q Sbjct: 277 SKNLLTWLNSMITLRIPNGTCKDCVLSNLFASLGKDNQY--TSSFLFFCYFLHFGNAYFQ 334 Query: 535 F 533 + Sbjct: 335 Y 335 Score = 30.7 bits (66), Expect = 1.2 Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -1 Query: 646 DAMLSFLFAIRGSDSKYQQTSSCLVICISIHV-NKHYQF 533 D +LS LFA G D++Y TSS L C +H N ++Q+ Sbjct: 71 DCVLSNLFASLGKDNQY--TSSFLFFCYFLHFGNAYFQY 107 >Z99102-2|CAB11775.1| 499|Caenorhabditis elegans Hypothetical protein B0331.1 protein. Length = 499 Score = 29.1 bits (62), Expect = 3.7 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +1 Query: 112 HNRIIKIAFHYVRLRGELIVFTDE 183 H RI+ AFH+ +L G L VF E Sbjct: 134 HRRILTPAFHFAKLEGYLDVFNSE 157 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,354,437 Number of Sequences: 27780 Number of extensions: 378877 Number of successful extensions: 864 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 833 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1851132448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -