BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120347.Seq (677 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak... 31 0.20 SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces po... 25 7.6 >SPBC1861.03 |mak10||NatC N-acetyltransferase complex subunit Mak10 |Schizosaccharomyces pombe|chr 2|||Manual Length = 708 Score = 30.7 bits (66), Expect = 0.20 Identities = 13/48 (27%), Positives = 28/48 (58%) Frame = +2 Query: 413 YVETSFIRLTECVCFEN*MSLFVVQREEIGRQRVKIRPGQPLAPARSR 556 +++T++++ C C N +SL ++ ++ ++ PG PL P+ SR Sbjct: 661 FLQTNYLKNLLCCCITNLVSLAILSKDHSANLKIVEIPGNPL-PSLSR 707 >SPBC336.11 |||GARP complex subunit Vps52 |Schizosaccharomyces pombe|chr 2|||Manual Length = 508 Score = 25.4 bits (53), Expect = 7.6 Identities = 9/19 (47%), Positives = 16/19 (84%) Frame = -1 Query: 167 IIVSIKYYRQKYLNSFPIQ 111 I+V+IK +RQ +++ FPI+ Sbjct: 151 IVVTIKMFRQAFVDVFPIR 169 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,596,373 Number of Sequences: 5004 Number of extensions: 51508 Number of successful extensions: 113 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 113 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 311890690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -