Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120347.Seq
         (677 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein...    25   2.9  

>AJ439353-6|CAD27928.1|  695|Anopheles gambiae putative G-protein
           coupled receptor protein.
          Length = 695

 Score = 24.6 bits (51), Expect = 2.9
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 1/60 (1%)
 Frame = +1

Query: 121 NEFKYFCL*YFIDTIISD*TSVLW-QHRNTVKESDEWSLLIRYI*ITRV*CAYIHIYVLY 297
           N F   CL   +  I S+ + +L  Q    V   +  +LL+ Y+ ++     +I+IYV+Y
Sbjct: 219 NAFYPICLNLLLALIASNLSFILGVQATRNVIRCELIALLLHYLHLSTSIWCFIYIYVIY 278


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 653,339
Number of Sequences: 2352
Number of extensions: 13086
Number of successful extensions: 54
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 54
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 54
length of database: 563,979
effective HSP length: 62
effective length of database: 418,155
effective search space used: 68159265
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)