BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120341.Seq (772 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_59218| Best HMM Match : M20_dimer (HMM E-Value=2) 60 3e-09 SB_9197| Best HMM Match : ITAM (HMM E-Value=4.2) 34 0.15 SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.34 SB_39672| Best HMM Match : Peptidase_M20 (HMM E-Value=9.9e-09) 31 1.4 SB_56221| Best HMM Match : AOX (HMM E-Value=3.6) 29 4.2 SB_42534| Best HMM Match : DUF699 (HMM E-Value=0) 29 4.2 SB_6120| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.6 >SB_59218| Best HMM Match : M20_dimer (HMM E-Value=2) Length = 233 Score = 59.7 bits (138), Expect = 3e-09 Identities = 24/26 (92%), Positives = 24/26 (92%) Frame = +2 Query: 686 VDYVCISDNYWLGTTKPCITYGLRGI 763 VDYVCISDNYWLG KPCITYGLRGI Sbjct: 137 VDYVCISDNYWLGKEKPCITYGLRGI 162 >SB_9197| Best HMM Match : ITAM (HMM E-Value=4.2) Length = 75 Score = 33.9 bits (74), Expect = 0.15 Identities = 18/41 (43%), Positives = 24/41 (58%), Gaps = 2/41 (4%) Frame = +1 Query: 391 KNTVCIYGHLDVQPALKSDGWET--EPFELVERNEKLYGRG 507 ++TV +YGHLD QP + GW P+ + KLYGRG Sbjct: 15 RDTVLLYGHLDKQP--EFSGWRAGLGPWTPKYEDGKLYGRG 53 >SB_52464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2529 Score = 32.7 bits (71), Expect = 0.34 Identities = 26/74 (35%), Positives = 37/74 (50%), Gaps = 2/74 (2%) Frame = +2 Query: 11 IFNTLIK-LPATKQLVPFFPAYHQHYSV-SSKQVSAKMATEKTLPEIFKYVDQNKDSYKQ 184 IF L K + TK VP A + + V SSK VS + AT TLPE+ + +D D+ + Sbjct: 1653 IFQRLDKRVTKTKSSVPLLAALRRCFVVASSKDVSPRRATTVTLPEL-RAMDDLADAADR 1711 Query: 185 LLKEAVAIPSVSCD 226 + + I S D Sbjct: 1712 RVAHVLPIASSESD 1725 >SB_39672| Best HMM Match : Peptidase_M20 (HMM E-Value=9.9e-09) Length = 702 Score = 30.7 bits (66), Expect = 1.4 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +1 Query: 406 IYGHLDVQPALKSDGWETEPFELVERNEKLYGRGLLMIKD 525 I HLDV PA S W+ PF+ ++ ++GRG L +K+ Sbjct: 464 IASHLDVVPAPGS--WDVPPFDGRVKDGYIWGRGTLDVKN 501 >SB_56221| Best HMM Match : AOX (HMM E-Value=3.6) Length = 361 Score = 29.1 bits (62), Expect = 4.2 Identities = 18/47 (38%), Positives = 27/47 (57%) Frame = +2 Query: 86 SVSSKQVSAKMATEKTLPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD 226 S SSK VS++ AT TLPE+ + +D D+ + + A+ I S D Sbjct: 18 SRSSKDVSSRRATTVTLPEL-RAMDDLADAADRRVAHALPIASSESD 63 >SB_42534| Best HMM Match : DUF699 (HMM E-Value=0) Length = 739 Score = 29.1 bits (62), Expect = 4.2 Identities = 16/42 (38%), Positives = 27/42 (64%), Gaps = 1/42 (2%) Frame = +3 Query: 522 GPVLGWLH-TINAYKGTGAELPVNLKFIFECMEESGSEGLTA 644 GP L ++ TIN Y+GTG L +LK + + ++S +G+T+ Sbjct: 128 GPYLVFMSSTINGYEGTGRSL--SLKLLQQLRQQSVPQGVTS 167 >SB_6120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 9.6 Identities = 19/58 (32%), Positives = 29/58 (50%) Frame = +2 Query: 53 VPFFPAYHQHYSVSSKQVSAKMATEKTLPEIFKYVDQNKDSYKQLLKEAVAIPSVSCD 226 +P P+ S SSK VS + AT TLPE+ + +D D+ + + + I S D Sbjct: 8 IPCRPSDVASSSRSSKDVSPRRATTVTLPEL-RAMDDLADAADRRVAHVLPIASSESD 64 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,740,697 Number of Sequences: 59808 Number of extensions: 519765 Number of successful extensions: 1379 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1307 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1379 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2095976575 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -