BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120341.Seq (772 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 27 0.85 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 26 1.1 AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. 25 2.6 AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcript... 25 3.4 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 26.6 bits (56), Expect = 0.85 Identities = 26/96 (27%), Positives = 34/96 (35%), Gaps = 4/96 (4%) Frame = -3 Query: 500 PYNFSLRSTSSKGSVSHPSDFKAGCTS-K*P*IQTVFFFGSLPNTPTKTGGS---*TSLP 333 P+ L TSSK + +HPS A S P + T G NTP T+ Sbjct: 726 PHGAPLALTSSKSASTHPSPHPATRASPSSPIVATSSSGGGGSNTPNSAAAPHPYYTAAA 785 Query: 332 SIV*KPTSLNSVVAPTSFNLSCIQ*TYGCNPHDISH 225 P SL+S P + G H + H Sbjct: 786 MAAASPLSLSSKAPPHPHSALSSHSPVGAGSHHLHH 821 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 26.2 bits (55), Expect = 1.1 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = +2 Query: 71 YHQHYSVSSKQVSAKMATEKTLPEIFKYVDQNKDSYKQL 187 YHQ + + K+ +K EI K ++NKD Y ++ Sbjct: 891 YHQRDKLLKQNDELKLEIKKKENEITKVRNENKDGYDRI 929 >AJ010299-1|CAA09070.1| 722|Anopheles gambiae stat protein. Length = 722 Score = 25.0 bits (52), Expect = 2.6 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +2 Query: 23 LIKLPATKQLVPFFPAYHQHYSVSSKQVSAKMATEKTLPEIFKYVDQNKD 172 LI P++ Q P Q S SSK + L EI+K+ +N D Sbjct: 662 LIFAPSSNQSSSSTPNAEQSPSASSKDTFSNEYVLTNLDEIYKFEIENDD 711 >AB090817-2|BAC57910.1| 1009|Anopheles gambiae reverse transcriptase protein. Length = 1009 Score = 24.6 bits (51), Expect = 3.4 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = -1 Query: 277 ICLASSEPTDAIRTIFH 227 +C A EP DA TIFH Sbjct: 913 LCDACEEPEDAEHTIFH 929 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 859,283 Number of Sequences: 2352 Number of extensions: 18272 Number of successful extensions: 33 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 80249979 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -