BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120334.Seq (756 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g13300.2 68416.m01675 transducin family protein / WD-40 repea... 28 7.7 At3g13300.1 68416.m01674 transducin family protein / WD-40 repea... 28 7.7 At2g12130.1 68415.m01306 hypothetical protein 28 7.7 >At3g13300.2 68416.m01675 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1309 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +1 Query: 460 LRAPRSNQNCG----AILRGLNNEYRISLAKKGGGCPIMNIHSEYTNSF 594 L++PRSN N G A+L NN ++ + P++N H+E SF Sbjct: 61 LQSPRSNHNPGTHILALLNNTNNGAPVANQEPSHQLPVVN-HNEIARSF 108 >At3g13300.1 68416.m01674 transducin family protein / WD-40 repeat family protein contains 2 WD-40 repeats (PF00400); autoantigen locus HUMAUTANT (GI:533202) [Homo sapiens] and autoantigen locus HSU17474 (GI:596134) [Homo sapiens] Length = 1344 Score = 27.9 bits (59), Expect = 7.7 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 4/49 (8%) Frame = +1 Query: 460 LRAPRSNQNCG----AILRGLNNEYRISLAKKGGGCPIMNIHSEYTNSF 594 L++PRSN N G A+L NN ++ + P++N H+E SF Sbjct: 96 LQSPRSNHNPGTHILALLNNTNNGAPVANQEPSHQLPVVN-HNEIARSF 143 >At2g12130.1 68415.m01306 hypothetical protein Length = 209 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 404 VWV*GWRRGTRPSPLGRLQWGSCPQQNGSKFHAKTLC 294 +W WR P LGR +G+C + ++A+ LC Sbjct: 170 LWNRSWRFVVSPDCLGRCSYGACCRNCFFYWYARELC 206 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,387,532 Number of Sequences: 28952 Number of extensions: 378612 Number of successful extensions: 1077 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1042 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1077 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1682736544 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -