BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120333.Seq (665 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_34988| Best HMM Match : zf-CCHC (HMM E-Value=3e-12) 31 1.1 SB_17977| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.4 SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_17241| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.9 SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) 28 5.9 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 28 7.9 SB_17934| Best HMM Match : PX (HMM E-Value=2e-19) 28 7.9 >SB_34988| Best HMM Match : zf-CCHC (HMM E-Value=3e-12) Length = 469 Score = 30.7 bits (66), Expect = 1.1 Identities = 15/44 (34%), Positives = 24/44 (54%) Frame = +3 Query: 348 SLHEWEDKLYPEPDKNIVVLEPANGKTTYTIGPRVQGKPCGFWF 479 S +ED+LY + N + L+PA+ + + I R Q + C WF Sbjct: 10 SYQAYEDELYGQTSPNSLSLQPAS-RLSAKILHRFQNRSCASWF 52 >SB_17977| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 337 Score = 29.1 bits (62), Expect = 3.4 Identities = 15/39 (38%), Positives = 22/39 (56%) Frame = +1 Query: 58 SDDNQPKRERVESGEDQQLVPYNNNNGAAFNVKHDETGV 174 SDDN+ +R + G D +N NG +NVK+ + GV Sbjct: 109 SDDNKGDIDRGDGGNDDSSGGNDNRNG-GYNVKNYDNGV 146 >SB_19562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 279 Score = 28.3 bits (60), Expect = 5.9 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = -2 Query: 484 SENQNPQGLPCTLGPMVYVVLPLAG 410 S + NPQ +P T P + VV+P AG Sbjct: 47 SVSPNPQAMPMTSRPQLKVVIPSAG 71 >SB_26485| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 801 Score = 28.3 bits (60), Expect = 5.9 Identities = 20/75 (26%), Positives = 34/75 (45%), Gaps = 5/75 (6%) Frame = +3 Query: 165 NGRNVLFYAVVRSIGATRVDKDVVAGANGDNVK-RGNFSILNCSCFEGRFLK----NEFC 329 +G N+ +A ++ +T + K +N+K NC CF +FLK N FC Sbjct: 479 HGNNLKDFAKQKAFTSTHISKWKELFPEMENLKCHCTRHSKNCGCFSKQFLKNARVNHFC 538 Query: 330 RLANLNSLHEWEDKL 374 L +S E+ ++ Sbjct: 539 CLQQCDSPEEYARRM 553 >SB_17241| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 327 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/40 (37%), Positives = 22/40 (55%) Frame = +3 Query: 186 YAVVRSIGATRVDKDVVAGANGDNVKRGNFSILNCSCFEG 305 Y + RSI ++ DKDV+A + KR F +L C +G Sbjct: 97 YELARSIISSSYDKDVIALERMLDGKRDGFYVLCCQISKG 136 >SB_12752| Best HMM Match : Borrelia_orfA (HMM E-Value=0.15) Length = 1774 Score = 28.3 bits (60), Expect = 5.9 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +1 Query: 37 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNNNGAAFN 150 +K GD+ D + P E+ ES EDQ+ +N AA N Sbjct: 826 KKGGDAGDDPSDPDEEKDESEEDQERKRHNKK--AALN 861 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 27.9 bits (59), Expect = 7.9 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +1 Query: 37 RKIGDSSSDDNQPKRERVESGEDQQLVPYNNNNGAAFNVK 156 R +G + S DN+ R+E+ ++L P N + +VK Sbjct: 127 RNLGSTGSSDNRTHYRRIETKAPRRLEPLKPNTASRTSVK 166 >SB_17934| Best HMM Match : PX (HMM E-Value=2e-19) Length = 586 Score = 27.9 bits (59), Expect = 7.9 Identities = 14/40 (35%), Positives = 20/40 (50%) Frame = -3 Query: 309 ICLRNNYNSVLKSCLVSHYRHLLLPQHLCQLAWLQLNGRR 190 ICL N+++ +C V HYR L L L W+ + R Sbjct: 526 ICLENSHSKTF-ACRVVHYRKLQLTAAQTLLKWVAITVTR 564 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,457,153 Number of Sequences: 59808 Number of extensions: 509905 Number of successful extensions: 1494 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1400 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1493 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1717720750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -