BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120331X.Seq (634 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_50446| Best HMM Match : HIT (HMM E-Value=1.6e-36) 44 1e-04 SB_40011| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 >SB_50446| Best HMM Match : HIT (HMM E-Value=1.6e-36) Length = 432 Score = 44.0 bits (99), Expect = 1e-04 Identities = 21/46 (45%), Positives = 27/46 (58%) Frame = +2 Query: 98 IFCNIANKLEGTEILYEDDEVCVFRDIKPASRFHILTIPKRHIEDV 235 IF I K EIL+EDD+ FRDI P + H+L IPK+ I + Sbjct: 7 IFGKIIRKEIPAEILHEDDQCLAFRDINPQAPTHVLVIPKKPIRQL 52 >SB_40011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/47 (27%), Positives = 23/47 (48%) Frame = -1 Query: 451 YYCLTTFRIFYNIITCLTYISIGVYPHIFIYLKL*PCLLHRHDEYLD 311 Y + T+ +T +TY++I Y I Y+ + +LH H + D Sbjct: 66 YMAIITYMTIITYMTIITYMTIITYMTIITYMTIITYILHDHHQLHD 112 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,614,990 Number of Sequences: 59808 Number of extensions: 304296 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 474 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -