BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120331X.Seq (634 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 22 5.7 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 22 5.7 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 7.5 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 9.9 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.8 bits (44), Expect = 5.7 Identities = 11/30 (36%), Positives = 14/30 (46%) Frame = +3 Query: 9 KACKF*SQKTSCSCLVKPKCQQRHHLNRPV 98 K C+ T C+ KC +RH RPV Sbjct: 91 KECELSPNSTIAVCVCMRKCPRRH---RPV 117 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.8 bits (44), Expect = 5.7 Identities = 9/17 (52%), Positives = 12/17 (70%) Frame = +3 Query: 513 QIILHGILQLTTTELVF 563 ++ + G QLT TELVF Sbjct: 98 EVTVTGTYQLTETELVF 114 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.4 bits (43), Expect = 7.5 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -1 Query: 274 FTYVVPCGARQALDIFDMPFRYSQNMKTTGRFDV 173 F Y+ P A D+ P+R ++ G F V Sbjct: 200 FGYLCPGMALSQFDLMGSPYRNLTFVRREGEFSV 233 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 9.9 Identities = 8/15 (53%), Positives = 10/15 (66%) Frame = +2 Query: 494 IIAFISANYFTRYSS 538 II F +YFT+Y S Sbjct: 291 IIQFAVVHYFTKYGS 305 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,941 Number of Sequences: 438 Number of extensions: 3632 Number of successful extensions: 15 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18949215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -