BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120330.Seq (765 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. 26 0.38 AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 25 0.88 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 22 4.7 >Z69742-1|CAA93624.1| 72|Tribolium castaneum arylphorin protein. Length = 72 Score = 25.8 bits (54), Expect = 0.38 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 382 RANHICDFVTIVGRKKVWVSFGQVVRNV 465 R H+ + +V R VWVSF Q +NV Sbjct: 19 RGEHMVGTIVVVVRG-VWVSFNQTAQNV 45 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 24.6 bits (51), Expect = 0.88 Identities = 13/48 (27%), Positives = 22/48 (45%) Frame = -1 Query: 663 YFFC*QLNLNVHHIFVWGIVGKLYTFRIL*YLTHIRRYKKIIRCSLNF 520 YF+C + NVH +F+ + +T +L Y I + C+ F Sbjct: 58 YFYCVSITFNVHLLFL--LCSGYFTVHLLFYCPFIIFTVHFLLCTYYF 103 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 22.2 bits (45), Expect = 4.7 Identities = 14/51 (27%), Positives = 27/51 (52%) Frame = -1 Query: 573 YLTHIRRYKKIIRCSLNFITLLRLSIIGKVNKFLS*YISYNLPKRNPHFLS 421 +L H+R+ + ++ + I L + + I K KFL ++ N K +P +S Sbjct: 471 HLEHLRQVFEKLKQARMTINLEKSNFIQKEVKFLGHILTINGIKADPEKIS 521 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 184,677 Number of Sequences: 336 Number of extensions: 4254 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20546262 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -