SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120328.Seq
         (898 letters)

Database: celegans 
           27,780 sequences; 12,740,198 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

U97014-1|AAB52425.1|  893|Caenorhabditis elegans Hypothetical pr...    32   0.48 

>U97014-1|AAB52425.1|  893|Caenorhabditis elegans Hypothetical
           protein T05E8.1 protein.
          Length = 893

 Score = 32.3 bits (70), Expect = 0.48
 Identities = 17/44 (38%), Positives = 25/44 (56%)
 Frame = +2

Query: 128 KRKIGDSSSDDNQPKRERVESGEDQQLVPYNNNNGAAFNVKHAK 259
           K K GDSSSDD+ P+R+R E   D +    +  + ++ N K  K
Sbjct: 13  KFKRGDSSSDDSGPERDRDEDDSDNESRNTSKTSKSSKNGKSGK 56


  Database: celegans
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 12,740,198
  Number of sequences in database:  27,780
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 22,013,627
Number of Sequences: 27780
Number of extensions: 509945
Number of successful extensions: 1580
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 1505
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1578
length of database: 12,740,198
effective HSP length: 81
effective length of database: 10,490,018
effective search space used: 2276333906
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -