BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120326.Seq (769 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase... 27 0.84 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 23 7.9 >U89800-1|AAD03793.1| 260|Anopheles gambiae Tc1-like transposase protein. Length = 260 Score = 26.6 bits (56), Expect = 0.84 Identities = 14/50 (28%), Positives = 23/50 (46%), Gaps = 1/50 (2%) Frame = +2 Query: 557 CAIFL*-LDLRQSVFFVHKTRHVRAICQRMQKSNHRIAPRGSRARVEYFE 703 CA++ LDL+ S V + H C R + ++ P AR+ + E Sbjct: 6 CALYKQELDLQVSAKTVSRRLHAAGFCARRPRKVRKLLPHHVEARIRFAE 55 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 23.4 bits (48), Expect = 7.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = -3 Query: 575 VIEKLHKYLCNQIVFVNN 522 VI+ YL NQ+ F+NN Sbjct: 1006 VIQNGMNYLSNQLAFINN 1023 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 859,129 Number of Sequences: 2352 Number of extensions: 18877 Number of successful extensions: 28 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 28 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 79834176 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -