BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120326.Seq (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 24 1.8 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.4 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 23 4.1 AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc fi... 22 7.2 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.5 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 9.5 DQ485319-1|ABF21078.1| 175|Apis mellifera icarapin variant 2 pr... 21 9.5 DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 pr... 21 9.5 AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-ri... 21 9.5 AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. 21 9.5 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 23.8 bits (49), Expect = 1.8 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 400 SSLSTLDEGLQNGWDIFLRPMFGMP 474 S++S L + L G+D +RP FG P Sbjct: 4 SNISELLDNLLRGYDNSVRPDFGGP 28 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 2.4 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 291 NILQSDAGTRRGRDHVSVVQARKQN 365 +I+Q+D TR D V ++A K+N Sbjct: 333 DIIQNDRRTRHLSDRVVALEAEKKN 357 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 22.6 bits (46), Expect = 4.1 Identities = 9/17 (52%), Positives = 13/17 (76%) Frame = +1 Query: 385 CRYLASSLSTLDEGLQN 435 C+ +ASS+S +EGL N Sbjct: 595 CKVIASSVSAGEEGLGN 611 >AB208106-1|BAE72138.1| 111|Apis mellifera Broad complex zinc finger domain-Z1 isoform protein. Length = 111 Score = 21.8 bits (44), Expect = 7.2 Identities = 6/13 (46%), Positives = 9/13 (69%) Frame = +2 Query: 260 PNLGPLCNTCKHI 298 P+ P+CN CK + Sbjct: 29 PSKEPICNICKRV 41 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 9.5 Identities = 13/41 (31%), Positives = 18/41 (43%) Frame = +3 Query: 489 VASDRLQNESDVINENNLITQIFVQFFYNLICDKAYSLYTK 611 +A D L D N+NNLI + ++ Y LY K Sbjct: 386 LARDILGYNFDFQNKNNLIPSALQSYSTSMRDPAFYMLYQK 426 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 9.5 Identities = 10/18 (55%), Positives = 14/18 (77%), Gaps = 1/18 (5%) Frame = +1 Query: 433 NGWDIFLRPMF-GMPLML 483 +G+DI LRP F G PL++ Sbjct: 46 DGYDIRLRPNFGGEPLLV 63 >DQ485319-1|ABF21078.1| 175|Apis mellifera icarapin variant 2 precursor protein. Length = 175 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 Query: 403 SLSTLDEGLQNGWDIFLRPMF 465 S DEG W+ LRP F Sbjct: 16 SFEDSDEGSNWNWNTLLRPNF 36 >DQ485318-1|ABF21077.1| 223|Apis mellifera icarapin variant 1 precursor protein. Length = 223 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 Query: 403 SLSTLDEGLQNGWDIFLRPMF 465 S DEG W+ LRP F Sbjct: 60 SFEDSDEGSNWNWNTLLRPNF 80 >AY939856-1|AAX33236.1| 223|Apis mellifera venom carbohydrate-rich protein precursor protein. Length = 223 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 Query: 403 SLSTLDEGLQNGWDIFLRPMF 465 S DEG W+ LRP F Sbjct: 60 SFEDSDEGSNWNWNTLLRPNF 80 >AY897570-1|AAW81036.1| 223|Apis mellifera venom protein 2 protein. Length = 223 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/21 (42%), Positives = 10/21 (47%) Frame = +1 Query: 403 SLSTLDEGLQNGWDIFLRPMF 465 S DEG W+ LRP F Sbjct: 60 SFEDSDEGSNWNWNTLLRPNF 80 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 220,040 Number of Sequences: 438 Number of extensions: 4555 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -