BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120325.Seq (758 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein c... 32 0.36 At3g32030.1 68416.m04070 terpene synthase/cyclase family protein... 28 7.7 >At1g10170.1 68414.m01147 NF-X1 type zinc finger family protein contains Pfam PF01422: NF-X1 type zinc finger; similar to transcriptional repressor NF-X1 (SP:Q12986) [Homo sapiens]; similar to EST gb|T21002 Length = 1188 Score = 32.3 bits (70), Expect = 0.36 Identities = 18/60 (30%), Positives = 26/60 (43%), Gaps = 1/60 (1%) Frame = -1 Query: 743 GLSLKSCRHDFVTV-ESQTRAGDEIASFLATVGCVECLAVNSSVFCNFGGLSMNGSWIFC 567 G CRH + D F T+ C C + ++V C+ GG S NGS ++C Sbjct: 754 GAPRTDCRHTCAALCHPSAPCPDLRCEFSVTITC-SCGRITATVPCDAGGRSANGSNVYC 812 >At3g32030.1 68416.m04070 terpene synthase/cyclase family protein contains Pfam profile: PF01397 terpene synthase family Length = 604 Score = 27.9 bits (59), Expect = 7.7 Identities = 12/25 (48%), Positives = 17/25 (68%) Frame = -1 Query: 758 LFELSGLSLKSCRHDFVTVESQTRA 684 LF LSLK +HDFV V++ T++ Sbjct: 29 LFPRPSLSLKPMKHDFVCVKATTKS 53 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,915,892 Number of Sequences: 28952 Number of extensions: 324775 Number of successful extensions: 1005 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 969 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1005 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1692519896 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -