BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120322.Seq (683 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0136 + 21158917-21159939,21160183-21160241,21160259-211602... 29 2.6 >03_05_0136 + 21158917-21159939,21160183-21160241,21160259-21160294, 21160345-21160387,21160582-21160698,21162090-21162179, 21162329-21162436,21162547-21162588 Length = 505 Score = 29.5 bits (63), Expect = 2.6 Identities = 20/47 (42%), Positives = 29/47 (61%), Gaps = 3/47 (6%) Frame = +1 Query: 205 EFLSKNKIIRFIKFLIFVPSLN*ILRIHILK--PPTYFK-LFISLFN 336 E +SKNK+ F ++LIF P L ++ +H+LK PP K FI +N Sbjct: 330 EAVSKNKLSIF-EWLIFFPKLRYMVYLHMLKCTPPLEIKHQFIKWWN 375 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,683,467 Number of Sequences: 37544 Number of extensions: 226358 Number of successful extensions: 341 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 341 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1733104716 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -