BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120322.Seq (683 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 22 6.3 AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. 22 6.3 DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor pro... 21 8.3 DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor pro... 21 8.3 AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled rec... 21 8.3 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = +1 Query: 133 LRRNGYKILKLHVLNQI 183 L+ +GYKIL H ++ I Sbjct: 247 LQTDGYKILYFHAMSSI 263 >AB022908-1|BAA86909.1| 493|Apis mellifera amylase protein. Length = 493 Score = 21.8 bits (44), Expect = 6.3 Identities = 9/27 (33%), Positives = 16/27 (59%) Frame = +3 Query: 585 EGFMILIAAC*YTAFSIWVDIINLHIN 665 E F+ ++A C I+VD+I H++ Sbjct: 95 EQFIDMVARCNKAGVRIYVDVIMNHMS 121 >DQ863218-1|ABI94394.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 183 IEYLNYIRILIQKQNYTFY*ISHLRAFFKL 272 I +L Y+ + YT + + + RAF +L Sbjct: 366 ITWLGYVNSALNPLIYTIFNLDYRRAFRRL 395 >DQ863217-1|ABI94393.1| 399|Apis mellifera tyramine receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 183 IEYLNYIRILIQKQNYTFY*ISHLRAFFKL 272 I +L Y+ + YT + + + RAF +L Sbjct: 366 ITWLGYVNSALNPLIYTIFNLDYRRAFRRL 395 >AJ245824-1|CAB76374.1| 399|Apis mellifera G-protein coupled receptor protein. Length = 399 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +3 Query: 183 IEYLNYIRILIQKQNYTFY*ISHLRAFFKL 272 I +L Y+ + YT + + + RAF +L Sbjct: 366 ITWLGYVNSALNPLIYTIFNLDYRRAFRRL 395 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 172,078 Number of Sequences: 438 Number of extensions: 3642 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -