Bombyx BLAST Result against mosquito

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= NV120311.Seq
         (762 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF364131-1|AAL35507.1|  378|Anopheles gambiae putative odorant r...    23   7.8  

>AF364131-1|AAL35507.1|  378|Anopheles gambiae putative odorant
           receptor Or2 protein.
          Length = 378

 Score = 23.4 bits (48), Expect = 7.8
 Identities = 12/40 (30%), Positives = 23/40 (57%), Gaps = 5/40 (12%)
 Frame = -3

Query: 388 LRLSAGW-----VYINKRFDILYLPII**THFVLCSRKKY 284
           L+L + W     + IN  F +LY  ++  T F++ +R+K+
Sbjct: 46  LKLYSSWGDMSELIINGYFTVLYFNLVLRTSFLVINRRKF 85


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 668,931
Number of Sequences: 2352
Number of extensions: 11189
Number of successful extensions: 101
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 101
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 101
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 79002570
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)