BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120307.Seq (816 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein pr... 23 2.9 U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. 22 6.7 EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglu... 22 6.7 AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain tran... 22 6.7 AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. 22 6.7 >AJ606487-1|CAE55183.1| 203|Tribolium castaneum Giant protein protein. Length = 203 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +1 Query: 268 NCRHEKFVFNSLGKEITIFDEVTYI 342 NC H KFV ++L KE+ ++ Y+ Sbjct: 174 NC-HLKFVTDTLKKELEKLQKIVYL 197 >U14732-1|AAC46491.1| 322|Tribolium castaneum fushi-tarazu protein. Length = 322 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 623 YLCQFTYMNNVIVQHSNTMTLFKH*TCNKGI 531 YL F +V H T L ++ TC +GI Sbjct: 66 YLNHFDNSVTPMVNHDFTQHLSQYDTCQQGI 96 >EF592539-1|ABQ95985.1| 630|Tribolium castaneum beta-N-acetylglucosaminidase FDL protein. Length = 630 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/9 (77%), Positives = 8/9 (88%) Frame = -2 Query: 659 RIAFFFSFC 633 R+ FFFSFC Sbjct: 8 RVLFFFSFC 16 >AY043292-2|AAK96032.1| 290|Tribolium castaneum homeodomain transcription factor Fushitarazu protein. Length = 290 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 623 YLCQFTYMNNVIVQHSNTMTLFKH*TCNKGI 531 YL F +V H T L ++ TC +GI Sbjct: 66 YLNHFDNSVTPMVNHDFTQHLSQYDTCQQGI 96 >AF321227-1|AAK16421.1| 290|Tribolium castaneum Ftz protein. Length = 290 Score = 21.8 bits (44), Expect = 6.7 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 623 YLCQFTYMNNVIVQHSNTMTLFKH*TCNKGI 531 YL F +V H T L ++ TC +GI Sbjct: 66 YLNHFDNSVTPMVNHDFTQHLSQYDTCQQGI 96 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,750 Number of Sequences: 336 Number of extensions: 4465 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22310335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -