BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120307.Seq (816 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.03c |mug145||ubiquitin-protein ligase E3 |Schizosacchar... 31 0.20 SPBC776.05 |||membrane transporter |Schizosaccharomyces pombe|ch... 25 9.7 >SPAC3A12.03c |mug145||ubiquitin-protein ligase E3 |Schizosaccharomyces pombe|chr 1|||Manual Length = 309 Score = 31.1 bits (67), Expect = 0.20 Identities = 15/37 (40%), Positives = 23/37 (62%) Frame = +2 Query: 314 LLFLMRLLIFQVIFMNFFNHKQIQCRAHFRHKLKEQQ 424 LLF + ++I VIF+NFF +C +F H L+ Q+ Sbjct: 24 LLFAL-VIILSVIFINFFFFYLCRCCVYFYHTLENQE 59 >SPBC776.05 |||membrane transporter |Schizosaccharomyces pombe|chr 2|||Manual Length = 404 Score = 25.4 bits (53), Expect = 9.7 Identities = 11/35 (31%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +2 Query: 47 KDNLKPWFAELNVDMDKIQE-IVRAIINLYEMWKS 148 K+ L+P ++N + DK++E + ++I E W S Sbjct: 69 KNKLQPIHKQINYETDKLKERLGKSIDKFQEQWNS 103 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,247,774 Number of Sequences: 5004 Number of extensions: 67500 Number of successful extensions: 158 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 154 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 158 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 398435810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -