BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120307.Seq (816 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value X62948-1|CAA44720.1| 267|Drosophila melanogaster Cyclin C protein. 118 1e-26 AY061425-1|AAL28973.1| 267|Drosophila melanogaster LD35705p pro... 118 1e-26 AE014297-1914|AAF55109.1| 267|Drosophila melanogaster CG7281-PA... 118 1e-26 >X62948-1|CAA44720.1| 267|Drosophila melanogaster Cyclin C protein. Length = 267 Score = 118 bits (284), Expect = 1e-26 Identities = 54/72 (75%), Positives = 61/72 (84%) Frame = +2 Query: 2 QIAIGALQIACVMLGKDNLKPWFAELNVDMDKIQEIVRAIINLYEMWKSYDEKKEIQGLL 181 QIAI LQIACV+L KD K WFAELNVD+DK+QEIVRAI+NLYE+WK + EK EIQ LL Sbjct: 196 QIAIACLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLL 255 Query: 182 SKMPKPKPAPQR 217 SK+PKPKP PQR Sbjct: 256 SKIPKPKPPPQR 267 >AY061425-1|AAL28973.1| 267|Drosophila melanogaster LD35705p protein. Length = 267 Score = 118 bits (284), Expect = 1e-26 Identities = 54/72 (75%), Positives = 61/72 (84%) Frame = +2 Query: 2 QIAIGALQIACVMLGKDNLKPWFAELNVDMDKIQEIVRAIINLYEMWKSYDEKKEIQGLL 181 QIAI LQIACV+L KD K WFAELNVD+DK+QEIVRAI+NLYE+WK + EK EIQ LL Sbjct: 196 QIAIACLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLL 255 Query: 182 SKMPKPKPAPQR 217 SK+PKPKP PQR Sbjct: 256 SKIPKPKPPPQR 267 >AE014297-1914|AAF55109.1| 267|Drosophila melanogaster CG7281-PA protein. Length = 267 Score = 118 bits (284), Expect = 1e-26 Identities = 54/72 (75%), Positives = 61/72 (84%) Frame = +2 Query: 2 QIAIGALQIACVMLGKDNLKPWFAELNVDMDKIQEIVRAIINLYEMWKSYDEKKEIQGLL 181 QIAI LQIACV+L KD K WFAELNVD+DK+QEIVRAI+NLYE+WK + EK EIQ LL Sbjct: 196 QIAIACLQIACVILQKDATKQWFAELNVDLDKVQEIVRAIVNLYELWKDWKEKDEIQMLL 255 Query: 182 SKMPKPKPAPQR 217 SK+PKPKP PQR Sbjct: 256 SKIPKPKPPPQR 267 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 33,156,785 Number of Sequences: 53049 Number of extensions: 644357 Number of successful extensions: 1632 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1577 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1631 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3839531124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -