BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120305.Seq (722 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 28 0.34 Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. 27 0.78 AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. 27 0.78 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 26 1.0 AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase ... 26 1.4 EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calc... 25 3.1 X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. 24 4.1 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 24 5.5 AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein p... 24 5.5 CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein ... 23 9.6 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.6 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 27.9 bits (59), Expect = 0.34 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 550 TDLSSPSTCTQNKRPEHTPLPSPV 621 +D+SSP T + P+ TP P+PV Sbjct: 168 SDMSSPGAPTGSSSPQITPRPTPV 191 >Y17689-1|CAA76814.1| 111|Anopheles gambiae gSG2 protein protein. Length = 111 Score = 26.6 bits (56), Expect = 0.78 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 304 IIAIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAG 471 ++A L VA+++ A+ NY G+ G G + FSG + G +I + D G Sbjct: 5 LVAFATLSVALVVVVAIPANFNYGGGGGYFINGTGQSFNFSGESNGTSIPGLPDFG 60 >AJ130950-1|CAA10259.1| 114|Anopheles gambiae SG2 protein protein. Length = 114 Score = 26.6 bits (56), Expect = 0.78 Identities = 17/56 (30%), Positives = 28/56 (50%) Frame = +1 Query: 304 IIAIYGLVVAVLIAGALQEPANYPLYKGFIHLGAGLAVGFSGLAAGFAIGIVGDAG 471 ++A L VA+++ A+ NY G+ G G + FSG + G +I + D G Sbjct: 5 LVAFATLSVALVVVVAIPANFNYGGGGGYFINGTGQSFNFSGESNGTSIPGLPDFG 60 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 26.2 bits (55), Expect = 1.0 Identities = 10/25 (40%), Positives = 15/25 (60%) Frame = +3 Query: 282 HSCRHGGYYCHLRSGRGCPDCWCPP 356 + C++G Y ++ SG GC C C P Sbjct: 921 NECKNG--YWNIVSGNGCESCNCDP 943 >AJ439060-8|CAD27759.1| 808|Anopheles gambiae putative V-ATPase protein. Length = 808 Score = 25.8 bits (54), Expect = 1.4 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 131 FQPFCLLNVGVFTGPKNCDDYLHTL 57 F P+ +L +G+ G + +LHTL Sbjct: 750 FWPWSVLTIGILVGMEGLSAFLHTL 774 >EF990671-1|ABS30732.1| 1256|Anopheles gambiae voltage-gated calcium channel alpha2-delta subunit 1 protein. Length = 1256 Score = 24.6 bits (51), Expect = 3.1 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 711 PKPYARWTRYRRRPSLCAS 655 P P +RW R+RRR L S Sbjct: 3 PLPQSRWWRWRRRHLLTGS 21 >X85217-1|CAA59483.1| 1231|Anopheles gambiae Anlar protein. Length = 1231 Score = 24.2 bits (50), Expect = 4.1 Identities = 9/14 (64%), Positives = 11/14 (78%) Frame = -1 Query: 260 GLSPTWRQYQFLTW 219 G S T RQ+QF+TW Sbjct: 1114 GSSRTVRQFQFITW 1127 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.8 bits (49), Expect = 5.5 Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = -3 Query: 462 SHDAYGETG-SQTRESY-SQTSTQVDEPFVKGVVGWLLEGTSNQDSHD 325 S D GE+ S +R S +T++QVD KG L+GT+ HD Sbjct: 1654 SSDVEGESECSSSRSSIVEETASQVDMKGRKGTNSSPLDGTTTIIIHD 1701 >AB090813-1|BAC57901.1| 724|Anopheles gambiae gag-like protein protein. Length = 724 Score = 23.8 bits (49), Expect = 5.5 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = -1 Query: 467 ASPTMPMAKPAARPENPTAKPAP 399 A M + PAA PTA P P Sbjct: 67 AEAAMDLEPPAAAQPTPTASPVP 89 >CR954256-6|CAJ14147.1| 207|Anopheles gambiae predicted protein protein. Length = 207 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 624 EHGRREWCVFRAFILCTGRW 565 E+G + VF F L TG+W Sbjct: 95 ENGHEVYAVFPRFHLYTGQW 114 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 9.6 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = -1 Query: 479 PRTPASPTMPMAKPAARPENPTAK 408 PRTP + + PA P++PT++ Sbjct: 1120 PRTPYGLSNGTSSPALPPKSPTSQ 1143 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 843,785 Number of Sequences: 2352 Number of extensions: 17978 Number of successful extensions: 92 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 90 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 92 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 73597131 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -