BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120304.Seq (794 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.1 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.7 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 21 8.6 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.4 bits (48), Expect = 2.1 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = +3 Query: 222 FIIITLKFNSLIFNLICFNLGILFFLCLTSLGVYIVII 335 FII T+ I FN+ +LF LCL ++++ + Sbjct: 173 FIIFTMHL-LFCCAFIFFNMHLLFLLCLDYFTLHLLFL 209 Score = 21.4 bits (43), Expect = 8.6 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +3 Query: 219 YFIIITLKFNSLIFNLICFNLGILFFLCL 305 Y II L + I F + +LF LC+ Sbjct: 105 YAFIILLCVYYFYYAFIIFTVHLLFLLCI 133 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.7 Identities = 9/30 (30%), Positives = 15/30 (50%) Frame = -2 Query: 637 PPLLYSILNPETNSLSPSAKSKGVRFVSAN 548 PP+ I+NP+ SPS + ++N Sbjct: 410 PPMQSQIINPQPQITSPSNTNTSTSSTNSN 439 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 615 NIEYRRGGFALIFLAEYSSILFIRMILVIINMGGYNLRFFF 737 N+E R F +F++ + +LF +L I+ + + FFF Sbjct: 290 NLEQSRY-FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFF 329 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 615 NIEYRRGGFALIFLAEYSSILFIRMILVIINMGGYNLRFFF 737 N+E R F +F++ + +LF +L I+ + + FFF Sbjct: 290 NLEQSRY-FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFF 329 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 615 NIEYRRGGFALIFLAEYSSILFIRMILVIINMGGYNLRFFF 737 N+E R F +F++ + +LF +L I+ + + FFF Sbjct: 290 NLEQSRY-FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFF 329 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/41 (29%), Positives = 22/41 (53%) Frame = +3 Query: 615 NIEYRRGGFALIFLAEYSSILFIRMILVIINMGGYNLRFFF 737 N+E R F +F++ + +LF +L I+ + + FFF Sbjct: 290 NLEQSRY-FIYMFVSVWKCLLFFVSVLFILLVKEGEVAFFF 329 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 101,887 Number of Sequences: 336 Number of extensions: 1454 Number of successful extensions: 7 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21583952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -