BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120304.Seq (794 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 24 1.4 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 24 1.4 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 22 5.7 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 22 5.7 Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 p... 21 10.0 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 10.0 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 21 10.0 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +3 Query: 240 KFNSLIFNLICFNLGILFFLCLTSLGVYIVIIAGWSSNSNYALL 371 K L ++CF ++ C+T G+Y+ + + S + LL Sbjct: 413 KRKELFIAIVCFVSYLIGLFCITEGGMYVFQLLDSYAVSGFCLL 456 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.2 bits (50), Expect = 1.4 Identities = 11/44 (25%), Positives = 21/44 (47%) Frame = +3 Query: 240 KFNSLIFNLICFNLGILFFLCLTSLGVYIVIIAGWSSNSNYALL 371 K L ++CF ++ C+T G+Y+ + + S + LL Sbjct: 466 KRKELFIAIVCFVSYLIGLFCITEGGMYVFQLLDSYAVSGFCLL 509 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 22.2 bits (45), Expect = 5.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -3 Query: 696 LKSFL*IKYLNIQPKKLKQIPLFYIQY*IQKLTLFHLQQNQKEFDLF 556 +K FL I + P+ + L+Y Q + LF L + K+FD+F Sbjct: 79 VKEFLSIYKHGMLPRG-ELFSLYYPQLLREMSALFKLFYHAKDFDIF 124 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 22.2 bits (45), Expect = 5.7 Identities = 15/47 (31%), Positives = 24/47 (51%) Frame = -3 Query: 696 LKSFL*IKYLNIQPKKLKQIPLFYIQY*IQKLTLFHLQQNQKEFDLF 556 +K FL I + P+ + L+Y Q + LF L + K+FD+F Sbjct: 79 VKEFLSIYKHGMLPRG-ELFSLYYPQLLREMSALFKLFYHAKDFDIF 124 >Y13429-1|CAA73841.1| 402|Apis mellifera dopamine receptor, D1 protein. Length = 402 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/24 (37%), Positives = 12/24 (50%) Frame = -2 Query: 634 PLLYSILNPETNSLSPSAKSKGVR 563 P++YSI N E +KG R Sbjct: 322 PIIYSIFNTEFREAFKRILTKGAR 345 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = +3 Query: 324 IVIIAGWSSNSNYALLGGLRSVAQTIS 404 ++ + W+S N + L +V QTIS Sbjct: 16 MIHLIAWASLENTGISDRLENVTQTIS 42 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 21.4 bits (43), Expect = 10.0 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = +3 Query: 678 FIRMILVIINMGGYNL 725 FIR++LVI+ GY L Sbjct: 54 FIRIVLVILLRAGYVL 69 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 120,940 Number of Sequences: 438 Number of extensions: 1857 Number of successful extensions: 8 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25125039 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -