BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120304.Seq (794 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putativ... 54 1e-07 >At2g07785.1 68415.m00946 NADH-ubiquinone oxidoreductase, putative similar to NADH-ubiquinone oxidoreductase chain 1 (EC 1.6.5.3) (Swiss-Prot:Q01300) [Petunia hybrida] Length = 99 Score = 54.0 bits (124), Expect = 1e-07 Identities = 24/63 (38%), Positives = 36/63 (57%) Frame = +1 Query: 64 LGYIQIRKGPNKVGFIGLLQPFSDAIKLFTKERTYPNFSNYFCYYFSPVFRFIXXXXXXX 243 + ++Q RKGP+ VG GLLQP +D KL KE P+ +N+F + +PV F+ Sbjct: 1 MAFVQRRKGPDVVGSFGLLQPLADGSKLILKEPISPSSANFFLFRMAPVATFMLSLVARA 60 Query: 244 XIP 252 +P Sbjct: 61 VVP 63 Score = 35.9 bits (79), Expect = 0.031 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = +3 Query: 276 NLGILFFLCLTSLGVYIVIIAGWSSN 353 N+G+L+ ++SLGVY +IIAG SSN Sbjct: 74 NIGLLYLFAISSLGVYGIIIAGRSSN 99 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,618,280 Number of Sequences: 28952 Number of extensions: 113764 Number of successful extensions: 294 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 276 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 294 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1794809600 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -