BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120303.Seq (856 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_06_0057 + 25253497-25253589,25253722-25253799,25254583-252546... 29 3.6 >05_06_0057 + 25253497-25253589,25253722-25253799,25254583-25254621, 25254724-25255263,25255352-25255450,25255614-25255691, 25255961-25256146,25256240-25256365 Length = 412 Score = 29.5 bits (63), Expect = 3.6 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 850 PPNLFGLIEELHKQIKISFGLNMTGVTNGLL 758 PPN+ + ++H Q+ SFGL+ T +L Sbjct: 214 PPNMQPFVHQMHPQVPSSFGLSHTNAPQHML 244 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,936,761 Number of Sequences: 37544 Number of extensions: 249773 Number of successful extensions: 355 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 352 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 355 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2385713652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -