BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120296.Seq (650 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0060 + 3729613-3729863,3730377-3730392 28 5.6 02_05_0642 + 30576158-30576289,30576436-30576503,30577167-305774... 28 5.6 02_05_1314 - 35661824-35661912,35662031-35662454,35662689-356627... 28 7.4 >09_02_0060 + 3729613-3729863,3730377-3730392 Length = 88 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 236 ANWPPGRY*ALRLIVCSRLIPPIRC 162 A WPP RY + R C R +P + C Sbjct: 35 AKWPPSRYRSYR-ATCCRAVPSLLC 58 >02_05_0642 + 30576158-30576289,30576436-30576503,30577167-30577487, 30578318-30579146 Length = 449 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/22 (45%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -1 Query: 191 CSRLIPPIRC-SALNWATPRLR 129 CS +PP+RC L W+ PR++ Sbjct: 23 CSSRLPPLRCFVGLRWSAPRIQ 44 >02_05_1314 - 35661824-35661912,35662031-35662454,35662689-35662787, 35662886-35662995,35663263-35663516,35664080-35664098, 35664834-35665075,35665662-35666401 Length = 658 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = +1 Query: 250 RYKLSQMYIAEKPLSIDDIVKEGSNKVGTNSIFLGTVYDYGVKSPNAAS 396 R ++ Q Y+ E+PLS+ ++ + S + +G Y G + A S Sbjct: 217 RVEIRQFYLGEEPLSVRNVERRTSRRANDLQYQIGLRYTGGARMALALS 265 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,593,118 Number of Sequences: 37544 Number of extensions: 362697 Number of successful extensions: 950 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 926 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 950 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1620349964 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -