BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120296.Seq (650 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 pro... 25 2.1 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 25 2.1 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 24 4.8 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 24 4.8 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 24 4.8 AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. 24 4.8 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 24 4.8 AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcript... 24 4.8 AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/T... 23 8.4 AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/T... 23 8.4 >DQ219483-1|ABB29887.1| 961|Anopheles gambiae cryptochrome 2 protein. Length = 961 Score = 25.0 bits (52), Expect = 2.1 Identities = 15/52 (28%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +1 Query: 250 RYKLSQMYIAEKPLSIDDIVKEGSNKVGTNSIFLGT--VYDYGVKSPNAAST 399 +++ SQ+ + + S+D +E SN V + GT V +Y P++ ST Sbjct: 621 QHQQSQLQHSHQAQSLDQQSQENSNSVANSEQRYGTLPVAEYAAIKPDSLST 672 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 25.0 bits (52), Expect = 2.1 Identities = 11/32 (34%), Positives = 15/32 (46%) Frame = -3 Query: 624 TPECSWICAIRAPLVRTAAPCWGRSSTQSCCR 529 T C + A+ +R AAP W + T CR Sbjct: 788 TSRCRLLAAVADSTMRYAAPVWHGALTNRECR 819 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +2 Query: 509 WHVAIRSRQHDCVLXRPQHGAAVR 580 WH A+ +R+ +L R Q AA+R Sbjct: 809 WHGALTNRECRSLLKRVQRKAAIR 832 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 597 LRKSNCTLVYPK 632 LRK NCTL +PK Sbjct: 74 LRKLNCTLYHPK 85 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 597 LRKSNCTLVYPK 632 LRK NCTL +PK Sbjct: 74 LRKLNCTLYHPK 85 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 597 LRKSNCTLVYPK 632 LRK NCTL +PK Sbjct: 74 LRKLNCTLYHPK 85 >AF444783-1|AAL37904.1| 1356|Anopheles gambiae Trex protein. Length = 1356 Score = 23.8 bits (49), Expect = 4.8 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = -1 Query: 530 DFESQHAMSSTVLVGVIPL-NTINMDLNS 447 DF + SST+ G IPL N IN +L S Sbjct: 987 DFLVYYDNSSTLCTGAIPLENVINGNLTS 1015 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.8 bits (49), Expect = 4.8 Identities = 9/12 (75%), Positives = 10/12 (83%) Frame = +3 Query: 597 LRKSNCTLVYPK 632 LRK NCTL +PK Sbjct: 108 LRKLNCTLYHPK 119 >AB090821-2|BAC57918.1| 1168|Anopheles gambiae reverse transcriptase protein. Length = 1168 Score = 23.8 bits (49), Expect = 4.8 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -3 Query: 606 ICAIRAPLVRTAAPCWGRSSTQSCCR 529 + A+ A ++R AP W ++ CR Sbjct: 789 LAAVAASIIRYGAPVWTEATDLQWCR 814 >AJ441131-7|CAD29636.1| 1977|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1977 Score = 23.0 bits (47), Expect = 8.4 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 328 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 459 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 >AJ439398-6|CAD28129.1| 1978|Anopheles gambiae putative Tyr/Ser/Thr phosphatase protein. Length = 1978 Score = 23.0 bits (47), Expect = 8.4 Identities = 16/45 (35%), Positives = 21/45 (46%), Gaps = 1/45 (2%) Frame = +1 Query: 328 VGTNSIFLGTVYD-YGVKSPNAASTSSNVTMTRGTANFDIKEFKS 459 VG S + V D SP + S N +MT+ + DIKE S Sbjct: 635 VGIGSTSVDAVGDAMASSSPASCSPEQNGSMTKTRSYSDIKEATS 679 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 701,524 Number of Sequences: 2352 Number of extensions: 14281 Number of successful extensions: 42 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 42 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 64395870 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -