BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120296.Seq (650 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g30260.1 68414.m03701 expressed protein 35 0.054 At5g23890.1 68418.m02806 expressed protein weak similarity to SP... 30 1.5 At2g36810.1 68415.m04514 expressed protein 29 2.7 At1g16970.1 68414.m02061 Ku70-like protein identical to Ku70-lik... 27 8.2 >At1g30260.1 68414.m03701 expressed protein Length = 97 Score = 34.7 bits (76), Expect = 0.054 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 7/66 (10%) Frame = +1 Query: 301 DIVKEGSNKVGTNSIFLGTVYDYGVKSP-------NAASTSSNVTMTRGTANFDIKEFKS 459 D +KE +VGT+SIF + + SP + +S S++ + T G F + E + Sbjct: 31 DTIKEEEREVGTDSIFPSSFNSKKISSPFTSPYSSSVSSASASASCTSGLNKFPVTENRG 90 Query: 460 MFIVFK 477 F VFK Sbjct: 91 SFPVFK 96 >At5g23890.1 68418.m02806 expressed protein weak similarity to SP|P12957 Caldesmon (CDM) {Gallus gallus} Length = 946 Score = 29.9 bits (64), Expect = 1.5 Identities = 16/50 (32%), Positives = 26/50 (52%) Frame = +2 Query: 107 TNALNLNSLTEASPSLGQSSESVESDENKRLNVKLNNARVANLRIAHGDI 256 T ++SLT S+ QSS+ + SDE K N + +N + + I D+ Sbjct: 120 TKKQEMHSLTSQQESMIQSSDEISSDEIKVANSEESNLKDEDKSIESNDV 169 >At2g36810.1 68415.m04514 expressed protein Length = 1071 Score = 29.1 bits (62), Expect = 2.7 Identities = 14/33 (42%), Positives = 22/33 (66%) Frame = +1 Query: 4 CTT*ISLELKL*IKTNHVENRVIDRFARTDLSL 102 CTT +S+E KL I+T + +++D+F LSL Sbjct: 618 CTTLVSVEPKLTIETRNRVMKILDQFFSISLSL 650 >At1g16970.1 68414.m02061 Ku70-like protein identical to Ku70-like protein GI:12006424 from [Arabidopsis thaliana]; contains Pfam profiles PF03731: Ku70/Ku80 N-terminal alpha/beta domain, PF02735: Ku70/Ku80 beta-barrel domain, PF03730: Ku70/Ku80 C-terminal arm, and PF02037: SAP domain; contains TIGRfam profile TIGR00578: ATP-dependent DNA helicase ii, 70 kDa subunit Length = 621 Score = 27.5 bits (58), Expect = 8.2 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +2 Query: 116 LNLNSLTEASPSLGQSSESVESDENKRLNVK 208 LN + LTE PS+GQ E ++ KR+ K Sbjct: 234 LNSDELTEFMPSVGQKLEDMKDQLKKRVLAK 264 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,067,747 Number of Sequences: 28952 Number of extensions: 284233 Number of successful extensions: 763 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 748 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 763 length of database: 12,070,560 effective HSP length: 78 effective length of database: 9,812,304 effective search space used: 1354097952 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -