BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120295.Seq (716 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 2.5 AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. 22 4.3 EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 ... 21 7.6 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/31 (29%), Positives = 15/31 (48%) Frame = +1 Query: 481 PYRATSSKPTQPHHVAGRLHARGANERDRLH 573 PY A PT H + G + G ++D ++ Sbjct: 51 PYHANHVNPTANHVMGGAVPDVGKRDKDAIY 81 >AY563109-1|AAS99587.1| 46|Tribolium castaneum aristaless protein. Length = 46 Score = 22.2 bits (45), Expect = 4.3 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = +2 Query: 479 SHTAQQVQSQHNRITLLEDYTREELMNVIGSTMTERQI 592 S+ ++++ +R + +TREEL IG T Q+ Sbjct: 6 SYQLEELEKAFSRTHYPDVFTREELAMKIGLTEARIQV 43 >EU008544-1|ABS31131.1| 493|Tribolium castaneum cytochrome P450 protein. Length = 493 Score = 21.4 bits (43), Expect = 7.6 Identities = 8/25 (32%), Positives = 16/25 (64%) Frame = +2 Query: 515 RITLLEDYTREELMNVIGSTMTERQ 589 R+T ++ + L+NV +T+ ER+ Sbjct: 230 RLTFVDKTASDYLINVFKTTLQERE 254 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 163,498 Number of Sequences: 336 Number of extensions: 3189 Number of successful extensions: 9 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19051215 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -