BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120293.Seq (753 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL034489-10|CAA22464.2| 272|Caenorhabditis elegans Hypothetical... 28 6.2 AF099925-10|AAC69504.1| 138|Caenorhabditis elegans Fatty acid/r... 28 6.2 >AL034489-10|CAA22464.2| 272|Caenorhabditis elegans Hypothetical protein Y7A5A.3 protein. Length = 272 Score = 28.3 bits (60), Expect = 6.2 Identities = 13/29 (44%), Positives = 20/29 (68%) Frame = +2 Query: 191 KQHSNKQGAKCLRNATNLRLVFTARGVRL 277 KQHSNK GA C++ TN+ + A G+++ Sbjct: 168 KQHSNKNGA-CVQVHTNMYPIKVATGMKM 195 >AF099925-10|AAC69504.1| 138|Caenorhabditis elegans Fatty acid/retinol binding proteinprotein 7, isoform a protein. Length = 138 Score = 28.3 bits (60), Expect = 6.2 Identities = 18/57 (31%), Positives = 29/57 (50%), Gaps = 5/57 (8%) Frame = +1 Query: 385 QISCKH-EFGRAILSV---GQPRKGGIHPVEIG-AQR*YHQRTATICEPVYKMPIDD 540 ++S KH E G+ + +V + R G+ P + A++ H T T+C PIDD Sbjct: 52 EVSKKHPELGKRLATVLEGNKKRLDGLSPAAVEYAKKLIHMVTTTLCSLTVGKPIDD 108 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,967,097 Number of Sequences: 27780 Number of extensions: 295080 Number of successful extensions: 873 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 836 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 873 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1788025660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -