BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= NV120293.Seq (753 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g24320.1 68416.m03054 DNA mismatch repair MutS family (MSH1) ... 36 0.022 At5g43210.1 68418.m05280 endo/excinuclease amino terminal domain... 33 0.15 At3g49800.1 68416.m05445 BSD domain-containing protein contains ... 28 5.8 >At3g24320.1 68416.m03054 DNA mismatch repair MutS family (MSH1) low similarity to SP|Q56239 DNA mismatch repair protein mutS {Thermus aquaticus}; contains Pfam profiles PF05190: MutS family domain IV, PF01624: MutS domain I, PF01541: Endo/excinuclease amino terminal domain Length = 1118 Score = 36.3 bits (80), Expect = 0.022 Identities = 14/32 (43%), Positives = 22/32 (68%) Frame = +2 Query: 119 CVYILRQDNGKLYTGITSNLNRRIKQHSNKQG 214 CVY++R+ + +LY G T +L RI+ H K+G Sbjct: 1026 CVYVMRRPDKRLYIGQTDDLEGRIRAHRAKEG 1057 >At5g43210.1 68418.m05280 endo/excinuclease amino terminal domain-containing protein contains Pfam domain PF01541: Endo/excinuclease amino terminal domain Length = 170 Score = 33.5 bits (73), Expect = 0.15 Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 4/42 (9%) Frame = +2 Query: 107 NKVWCVYILRQDNG--KLYTGITSNLNRRIKQHSN--KQGAK 220 +K W VY++ K Y GIT++ +RR+KQH+ + GAK Sbjct: 51 SKSWSVYLILSTTEPIKTYVGITTDFSRRLKQHNGEIRGGAK 92 >At3g49800.1 68416.m05445 BSD domain-containing protein contains Pfam profile PF03909: BSD domain Length = 428 Score = 28.3 bits (60), Expect = 5.8 Identities = 14/36 (38%), Positives = 21/36 (58%), Gaps = 1/36 (2%) Frame = -1 Query: 255 NTSRKLVALRKHLAPC-LFECCFMRLLRLLVMPVYN 151 N + L ALR L P + E CF R+ +LV P+++ Sbjct: 213 NLASSLAALRIELCPAYMSEYCFWRIYFVLVHPIFS 248 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,778,560 Number of Sequences: 28952 Number of extensions: 258800 Number of successful extensions: 620 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 609 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 620 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1672953192 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -